CAZyme Information: PHPALM_8827-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_8827-t46_1-p1
• CAZy Family: GT71|GT71
• CAZyme Description: Pectin methylesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291		30337.54	4.7173

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01004905:60-935(-)

Full Sequence      

MHSFSLRLAILACLAAGAVTSAEEGCAGPSSWTGTPSSADGSAGSPSVSTSVSGSTSSSI
GVDSSGDDSGYKKSCSGPNARTEPPSGAIVVDATGAYNGSYLTVSEGVANIPNTTDEHTL
FVFPGVYEEQVTVPKFNGPLVLQGYTCNTMVYAENQVTITHKMAQKDLPANVTNARNQLV
STVVFKSKNGVKAYNLNIANPEGKIKELGQAVAVYVDNTNYGFYACNFTGYQDTLCANKG
KELYARSYISGAVDFIFGLQSKAWFESCDLESVGYGCVTANGNSNSSSLSQ

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	90	286	1.2e-41	0.6354166666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178372	PLN02773	3.56e-18	84	280	2	190	pectinesterase
215117	PLN02176	3.68e-18	89	280	41	224	putative pectinesterase
215340	PLN02634	8.23e-17	85	280	52	244	probable pectinesterase
395871	Pectinesterase	1.40e-16	89	270	2	165	Pectinesterase.
215383	PLN02713	1.49e-16	86	272	249	420	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54875.1|CE8	3.13e-127	74	291	21	238
ACO54870.1|CE8	2.76e-111	75	291	23	239
ACO54874.1|CE8	1.15e-110	74	291	25	242
ACO54872.1|CE8|3.1.1.11	1.00e-106	75	291	25	242
CCD28201.1|CE8	2.58e-103	74	291	40	257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.29e-35	80	287	2	193	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.81e-35	80	287	2	193	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	2.16e-11	89	270	1	168	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	7.58e-44	80	290	19	222	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	4.78e-41	80	287	19	218	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	1.44e-36	81	280	28	211	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.44e-36	81	280	28	211	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q2UBD9|PMEA_ASPOR	5.54e-36	81	280	28	211	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000342	0.999623	CS pos: 22-23. Pr: 0.9429

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_8827-t46_1-p1.