CAZyme Information: PHPALM_7939-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_7939-t46_1-p1
• CAZy Family: GT71
• CAZyme Description: Pectin lyase-8

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244		25737.23	9.6557

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01004153:1-731(-)

Full Sequence      

MQIFRVIIVAIAAFAVQGTQALSTGTAPGLAAGTTGGGNANPVYPTSLAELKNYLKDSQP
RVIVLKTTFDFRGTEGTTTENGCRPKSNRDCLAKNNGHKGQDVILQSGGMANTGGCVEGT
SVKVTYDLAATKNPLVVTSNKTLRGVGTSGVIKGKGLWIQGDNVIIQNIHITQLNPHLIW
GGDAIYIQGLNSGKTAMQRVWLDHIKISNIGRQMIATNTASVKSLTISNSEFDGQTQYSA
TCDG

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	124	244	2.2e-50	0.6042780748663101

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.21e-19	122	244	2	113	Amb_all domain.
226384	PelB	8.58e-08	97	209	51	165	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	5.91e-05	132	234	27	136	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19247.1|PL1_4|4.2.2.10	1.35e-166	1	244	1	244
ACR19251.1|PL1_4	1.35e-166	1	244	1	244
ACR19255.1|PL1_4	7.78e-166	1	244	1	244
ACR19249.1|PL1_4	2.55e-143	1	244	1	278
AHX74067.1|PL1_4	2.55e-143	1	244	1	278

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.01e-51	25	244	5	208	Pectin Lyase B [Aspergillus niger]
1IDK_A	7.98e-47	24	244	4	208	Pectin Lyase A [Aspergillus niger]
1IDJ_A	4.39e-46	24	244	4	208	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00374|PELA_COLGL	1.22e-57	10	243	10	228	Pectin lyase OS=Colletotrichum gloeosporioides OX=474922 GN=PNLA PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	1.73e-56	1	244	1	228	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	1.71e-55	16	244	18	230	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	1.71e-55	16	244	18	230	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q5BA61|PELB_EMENI	1.14e-54	8	244	7	227	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000187	0.999783	CS pos: 21-22. Pr: 0.9796

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_7939-t46_1-p1.