CAZyme Information: PHPALM_7873-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_7873-t46_1-p1
• CAZy Family: GT71
• CAZyme Description: Glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366		38962.24	4.1371

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01004091:772-1955(-)

Full Sequence      

MVFGIPCSIKAIVVTASLLLAATSSFAEDLCSIPPNSYTQAKTDHPELSKALEVLDQHAI
ASWFTDRMTTSERSSMISSMLNQCSEDTRLSIVVYGIPNKDCDAGYSSGGSVKSTDDYKA
FLKELTDAVGERKVLYVVEPDAVGLLAKEGSCGSSAGYLDNLKVAVEALSANANAELYVD
VGYWMLADSTNAAKIAPIMQELSTCGRVKGVTINTSNYRSNDECTTYCTNFFQTAMGSTS
MTCAVDTSRNYNGSPTSDWCNVATAGIGKPPSSETGISNIDYFMWIKPPGESDGECSGGP
AAGSFYLDGFTKLWDQGYFVGEGGMKTIADGTGDVTQQTSQTSSQTGTQTSGSNVDQEFY
IDFCSN

Enzyme Prediction     

No EC number prediction in PHPALM_7873-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	39	297	6e-57	0.9489795918367347

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	4.23e-42	46	301	2	292	Glycosyl hydrolases family 6.
227616	CelA1	1.87e-15	84	306	180	399	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23635.1|GH6	2.22e-158	18	337	6	331
AIG55974.1|GH6	1.32e-88	16	328	11	324
UIZ23641.1|GH6	1.48e-87	14	332	9	335
AIG55776.1|CBM1|GH6	2.72e-82	14	326	6	306
AIG55493.1|GH6	1.02e-80	15	339	10	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UP3_A	9.21e-26	92	305	73	280	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	9.21e-26	92	305	73	280	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	1.34e-25	92	305	94	301	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]
1TML_A	1.51e-25	92	305	70	274	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]
1UP2_A	2.43e-25	92	305	73	280	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26222|GUN2_THEFU	6.47e-24	92	305	101	305	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P07984|GUNA_CELFI	6.92e-24	92	308	238	438	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|P26414|GUNA_THEBI	1.85e-23	92	294	104	301	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P13933|GUN1_STRSS	2.65e-21	61	305	113	348	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3
sp|Q7SIG5|GUN6_HUMIN	7.20e-20	86	316	77	340	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000320	0.999653	CS pos: 27-28. Pr: 0.9738

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_7873-t46_1-p1.