CAZyme Information: PHPALM_7758-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_7758-t46_1-p1
• CAZy Family: GT71
• CAZyme Description: Glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308		34225.66	4.8121

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01003999:8-2527(-)

Full Sequence      

MFDAKTGDAFAVKGIDYYPRPNTGDLDENNHDFFTDDNEAIWRPDIEYLAQSGANAVRLY
AVDPSKSHDLFMCALRAKGMYALVDLALYAAFAVTDIQGYTNPIVIKNYKMFDAKTGAAF
AVKGIDYYPRPNTGEYDENNRDFFTDDFEDVWSPDIDYLAATGANAVRLYAVDPSKSHDK
FMCALRAKGMYALIDFAASCLNCAITKQAYPACYPADLKTRGEMIILAFAKYDNVLAFSA
GNEVNNEVAADATINAPCQKKFIRDMRAFVGNCPSIRKIPVGVVLADPDLSKNNRELNAK
YYNCRTAT

Enzyme Prediction     

No EC number prediction in PHPALM_7758-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	100	306	1.8e-55	0.6282051282051282

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	1.40e-36	100	304	8	200	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27746.1|GH72	1.78e-105	80	306	1	226
AIG55987.1|GH72	5.06e-86	86	306	28	238
AIG55654.1|GH72|GT31	1.77e-82	84	306	3	220
CCA23775.1|GH72	1.50e-78	102	306	23	221
AIG55902.1|GH72	1.50e-78	101	306	17	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.98e-22	76	304	3	231	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	7.68e-13	1	87	43	134	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	7.68e-13	1	87	43	134	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q08193|GAS5_YEAST	3.16e-22	91	304	17	215	1,3-beta-glucanosyltransferase GAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS5 PE=1 SV=1
sp|Q06135|GAS2_YEAST	1.02e-21	76	304	3	231	1,3-beta-glucanosyltransferase GAS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS2 PE=1 SV=1
sp|Q03655|GAS3_YEAST	8.89e-20	88	306	8	228	Probable 1,3-beta-glucanosyltransferase GAS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS3 PE=1 SV=1
sp|Q9Y7Y7|GAS4_SCHPO	8.04e-19	101	304	25	211	1,3-beta-glucanosyltransferase gas4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas4 PE=1 SV=1
sp|Q5AJY5|PGA4_CANAL	1.45e-18	104	304	22	207	1,3-beta-glucanosyltransferase PGA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PGA4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000098	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_7758-t46_1-p1.