CAZyme Information: PHPALM_7068-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_7068-t46_1-p1
• CAZy Family: GT66
• CAZyme Description: Hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500		55939.01	6.1979

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01003653:4218-5815(-)

Full Sequence      

MWDSFILLQLVSLVAIAMGGPSLEITFPAQHSHWQVSNEDGLLSTLPVYYQTRNFRIPDH
GFLLVTGDNIPSDGYRLTSEVNSLFLGEIDPGTQFWTFELRSWNESSVGAEVTLHVEVVV
DISDEHSPWRHTLREEEKRKRVFVNPKFSYDQRGSHLSQVLPVCYATTTSGAFDGQKRMW
LQIMKGLSDGYHGEFQFEVKTFEQVIPETPVARALKKVNVSLHGLPLEIPRNELSEEEAT
PDGVIRALLASFYRQFPSAEHDSRHISELDQPALLKLRPPYAARVWKNLVDSLRSPCADG
IIVFSNSRRLSDELLVLAARLTGTHAVIMELANLHPTRLDVDMLLAPSHFSLEHYSVARN
VRARSRIVLSTGVDTEQFAPSAVPLPKNNSFIIGYVGRLASEKSLGILLAAMKILAPICP
QCKLRVIGDGPQKSQLKTIATEWDLLGTTVEFIDGIYNDDSALMDKFREMHVFASPMLTE
TLGLAVLEAMSGRGNFSRMV

Enzyme Prediction     

No EC number prediction in PHPALM_7068-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	387	491	6.6e-18	0.63125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340831	GT4_PimA-like	7.26e-22	252	491	37	289	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
340842	GT4-like	9.61e-19	342	492	147	291	glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases and includes a sequence annotated as alpha-D-mannose-alpha(1-6)phosphatidyl myo-inositol monomannoside transferase from Bacillus halodurans. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria and eukaryotes.
340844	GT4_UGDG-like	1.17e-18	341	491	148	298	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
223515	RfaB	1.21e-16	338	491	148	298	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
395425	Glycos_transf_1	2.49e-15	389	491	1	100	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55764.1|GT4	2.71e-38	60	491	52	435
AQT70139.1|GT4	9.51e-12	342	491	144	294
QBS37986.1|GT4	4.82e-11	323	491	135	309
AWI82217.1|GT4	6.37e-10	368	493	206	323
QXD33633.1|GT4	6.72e-10	345	491	154	295

PDB Hits     

PHPALM_7068-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8S4F6|SQD2_ARATH	1.28e-07	342	491	252	398	Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana OX=3702 GN=SQD2 PE=1 SV=1
sp|Q94BX4|PIGA_ARATH	4.39e-06	340	491	151	298	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Arabidopsis thaliana OX=3702 GN=PIGA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000194	0.999802	CS pos: 19-20. Pr: 0.9741

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_7068-t46_1-p1.