CAZyme Information: PHPALM_5964-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_5964-t46_1-p1
• CAZy Family: GT48
• CAZyme Description: Pectinesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		38592.67	4.1155

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01003395:2503-3576(-)

Full Sequence      

MKAFVPVVVFASVAIGLVNAAVVDDSDSASESFAPETCSGPNARIEPPAGAIVVDATGDY
DGSYVSMSEGVKTLDVTTTDAQTIFVMPGIYEEQVFIPKLSGALVIQGSTCDATSYVDNE
VTITQATAQKDLPREVTKGRNDLTSTMRFKPNNVKVYNINIANTAGNVGQAVAATVDGTG
YGFYGCNFTGYQDTLYANKGRQLYAKSYISGAVDFVFGSTAAAWFEDCDIETIGKGCITA
NGRNSEENPSYYVFNNARVFGSNPAGSSYLGRPWRPFARVVWQNSELSDVINPLGWSAWD
ATSSTNDVHFREFKNTGAGAPTDERVEFSLELKKAVDITEILGEDYESEWWVDTDYL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	59	333	2.1e-75	0.9236111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178113	PLN02497	5.55e-48	49	332	31	306	probable pectinesterase
395871	Pectinesterase	5.25e-46	52	326	2	272	Pectinesterase.
178051	PLN02432	1.50e-44	48	335	9	275	putative pectinesterase
215367	PLN02682	2.99e-44	48	350	67	366	pectinesterase family protein
215117	PLN02176	3.72e-44	49	335	38	313	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54869.1|CE8	1.62e-154	38	357	21	338
ABQ63096.1|CE8	2.79e-152	38	357	23	344
ACO54868.1|CE8	3.69e-152	32	357	17	343
ACO54873.1|CE8	7.97e-152	38	357	23	344
AFM08806.1|CE8	1.29e-146	34	357	17	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	2.93e-63	43	356	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	2.93e-63	43	356	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	5.01e-35	52	326	9	279	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	9.62e-30	49	328	3	277	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	1.20e-10	79	315	64	350	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	1.22e-84	43	357	19	331	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	3.91e-83	43	357	19	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	3.63e-67	44	356	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	3.63e-67	44	356	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	8.97e-65	44	356	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000183	0.999786	CS pos: 20-21. Pr: 0.9822

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_5964-t46_1-p1.