CAZyme Information: PHPALM_5009-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_5009-t46_1-p1
• CAZy Family: GT22
• CAZyme Description: Drug/Metabolite Transporter (DMT) Superfamily

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578		63928.63	8.2862

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01002476:598-3098(-)

Full Sequence      

MAQKDIPANITSGRNDLTSTLRLKSKNVKVYNLNVANTAGNVGQAVATIVDGSNYGFYAC
NFTGYQDTLYANKGPDLFAKSYISGAVDFVFGSKAKAWFESCDIETVGKGCITANGRTNS
SNPSYYVFNNARVYGSSGNGSAFLGRPWRPYARVVWQNSELGDVIHPDGWQKWNGDNDTE
NVDFKEFNNTGPGAATDRRVPFSSVRKEAVNITDILGDDYKSQWWVDTNFLQHSSELHNS
RYLVQRRTVRFIAMSIGTEKHVTEHRPLLPTTASDIKTEDRPHALLGISCVALSAVCFSL
MSTMVKFNTYTMTSIEAIFWRSIVAMTLNYICIWYSGKTLYVAPEDRMMLFYRCLAGFSS
ISFAFYALSQMVLADSSVIVFTSPVFTFFLGACLLHEHIDIPSFACAILSFGGLICVVRP
GFIFGYDHATAHTDGSWIAVGSALLGAIGQAFVFITVRKLKGIHFMVIVHYFMLFSMVGS
LLYMLLVQRVFVIPSTFGVWFAVVGSGVFTFVGQLLLTKGFQLEKAGIASVMRYLDVVCV
FIWDYLLLGEKINFWSVVGAAIICTCAAVIALRKAHSS

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	17	205	8.3e-64	0.6631944444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178113	PLN02497	1.56e-42	45	200	142	300	probable pectinesterase
395871	Pectinesterase	3.89e-42	37	213	98	290	Pectinesterase.
215357	PLN02665	2.44e-37	18	203	146	337	pectinesterase family protein
178051	PLN02432	1.42e-36	33	203	101	269	putative pectinesterase
178372	PLN02773	2.65e-36	43	203	120	279	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ63096.1|CE8	3.63e-122	2	231	112	344
ACO54873.1|CE8	1.03e-121	2	231	112	344
ACO54869.1|CE8	1.62e-121	1	231	109	338
AFM08806.1|CE8	1.89e-114	1	231	109	338
ACO54871.1|CE8	1.56e-107	18	230	126	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.03e-42	12	230	85	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.03e-42	12	230	85	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	4.35e-25	37	206	105	285	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	2.61e-24	9	200	72	275	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	1.22e-52	16	231	109	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	4.61e-52	16	230	110	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|B8NPS7|PMEA_ASPFN	5.55e-49	12	230	110	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q2UBD9|PMEA_ASPOR	1.07e-48	12	230	110	324	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	2.88e-48	12	230	110	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000055

TMHMM  Annotations     

Start	End
283	305
315	337
350	372
377	396
403	425
435	457
464	486
496	518
531	548
552	572