CAZyme Information: PHPALM_4823-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_4823-t46_1-p1
• CAZy Family: GT20
• CAZyme Description: Pectate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409		43783.09	6.1327

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01002361:1496-2725(+)

Full Sequence      

MNRLSLVITALVAAIQSANALTIGSPAGMATGTTGGGDVTPVYPTTTKELVAFLRDPKPQ
VVVLNTTFDFRTLEGNTTAEGCRPDYMRKCIALNNGFKSQDVILQDGGMANTGGCTNGVS
VNVTYDNAPFNRINVRGNKTIRGVGKSGVIMGKGLALNGDNIIVQNIHITDINPHLVWGG
DAITIQGLTDGTVPLKHIWLDHIKISRIGRQFLAVDKAGASSMTISNSDFDGHTEFSKTC
DGHHYWSFLLYGKHTGISIINNYIHYLSGRLPKVGGTADSNVVTHIANNFYKDNSYHSME
IGTNAYVLAEGNYFANTTQPLYDGDDPDVPGMVDGSIYAPLESSEDECTAQLGRLCEPNV
LEDSGAFGTRNGSTALAEMKSHPTIAHHKTQQAQQLTLSASNFGVGDLE

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	122	316	3.7e-80	0.9946524064171123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	3.01e-35	121	317	2	189	Amb_all domain.
226384	PelB	1.15e-15	133	353	97	312	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.38e-10	131	314	28	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19246.1|PL1_4	9.45e-264	1	409	1	410
AHX74066.1|PL1_4	3.84e-263	1	409	1	410
AHX74068.1|PL1_4	1.33e-167	15	408	16	399
ADN18834.1|PL1_4	1.33e-167	15	408	16	399
ADN18833.1|PL1_4	1.71e-158	14	408	15	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	6.15e-71	23	404	4	358	Pectin Lyase B [Aspergillus niger]
1IDJ_A	2.67e-69	24	367	5	321	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	2.67e-69	24	367	5	321	Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2R6A1|PELF_ASPNC	9.83e-81	13	408	16	383	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	9.83e-81	13	408	16	383	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|Q5BA61|PELB_EMENI	3.96e-80	3	408	2	379	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|A1CFS2|PELA_ASPCL	5.43e-80	10	367	8	340	Probable pectin lyase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=pelA PE=3 SV=1
sp|Q4WIS6|PELB_ASPFU	3.04e-79	10	401	8	372	Probable pectin lyase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999739	CS pos: 20-21. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_4823-t46_1-p1.