CAZyme Information: PHPALM_4593-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_4593-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: Putative endo-1,3-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		61632.76	4.9446

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01002239:1-1719(-)

Full Sequence      

MTGIWSALLLLWSAAHCVSAVPGADLKLQLPFPVASHPLQLSSSLFAASERLPLDARVAN
ATTTRPKLLADVPFPTGAWWTNLVLAEGQSAVVSMPYVHKILDEKLHVSFPFRVVAPKDI
EAGFISQMVVSSQTQSSLPLAHHVVNFDAFSTTVRFSRGQAEEFRVYLVRGSPYVTMEYT
QSRPVVEAKDGLMITRFKKLKGLTLMNGDDVPFATFAAELNNGQTWYLYASDKQLKLQLN
DNGQVTSDDEFTGVLRVALCNDAKVMPFLLESASVYAVGGDVTHSVDPQDSDKALLEFQW
NTKSFLTFHGKADDVTDEENNKLLMLALPHHMDVLQVQKDNKTLEKGKNKVLSDLRYTSI
RGLMEGVFGAVWYMKETLPAVEWNYADDGLFSDDFSGSFEDTDDKQRRIDMREKAIEAIL
KELPIDADKYPPPLSPDSYNFGKQVSRDARLLLIADKFNQEEVKQKLLAKVETEIADWLE
ATNVDHFVYDQTFGGVITNDGWHDDQADYGNGYYNDHHFHYGYFVYALATIRKFDPDFIE
KHAQACALI

Enzyme Prediction     

No EC number prediction in PHPALM_4593-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	70	547	4.9e-90	0.6366559485530546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397619	Glyco_hydro_81	3.63e-51	71	386	12	317	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
227785	Acf2	2.13e-38	73	540	89	533	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	3.48e-27	437	549	29	145	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29064.1|GH81	1.66e-315	1	549	1	557
CCA18874.1|GH81	1.17e-116	30	546	8	500
AUX46944.1|GH81	7.17e-59	33	544	52	503
UQA58532.1|CBM6|GH81	7.91e-57	73	542	300	707
AUX25756.1|GH81	1.52e-52	73	544	97	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	5.75e-25	75	545	42	504	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	5.94e-25	75	545	67	529	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.77e-23	75	545	42	504	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5UPI_A	2.97e-16	73	541	48	465	Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPM_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPN_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPO_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]
5V1W_A	2.97e-16	73	541	48	465	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	3.97e-18	168	539	145	480	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	9.70e-15	131	540	154	516	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	2.35e-14	73	545	460	921	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	4.89e-14	123	542	297	680	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.55e-11	73	537	110	547	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999761	CS pos: 20-21. Pr: 0.9718

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_4593-t46_1-p1.