CAZyme Information: PHPALM_4093-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_4093-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: Hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530		58976.36	4.4016

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01002029:1424-3016(+)

Full Sequence      

MKIQAAVAGLLSLVALSTISAEPSWHNLAISAPRYGRYLTRTASDEPFFWQADTAWELVH
RLNKTSIDFYLKTRAEQGYNVVQTVLVSELDGTTRPNFYGDLPFNNSDPTKPNEAYFELV
DWTVDLAASYGILMALVPTWGMYVNGGWHSTTPIFNDSNAYEWGKYIGDRYPGLPKILGG
DSNVLWSWNMSAVQAAWAEDPDQDLPSLLAPIEDTTSVWASMRAGLKESEKTQGYESVVL
YHPTAGWIVKPEITPLPYGHNMLPDEEDRVSIDAVQSGHATPDPTSTFTPAIGWDSTKNY
ENIAEMRDKFTGPVLDLENHYEGAHDSFSLTRPIWNASQVRNGLYHGVYGGAAGFTYGCN
SVWQMYEPRADLVSDAVYYDPQINQNASGSWRKDIFFEGATQIQYVTQPLQNLTTAVLET
LEPAREILTSPSDHTGKSVNTYEGTRYISILASQTRDRYYVYTGHGDAFSLRLDNGSGSR
LGSARWFSPRDGQYSVTSTVNIPESDGTLIDFTPPSTGGVDNDWLLVLEF

Enzyme Prediction     

No EC number prediction in PHPALM_4093-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	36	525	4.9e-80	0.9757281553398058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	1.82e-122	36	413	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	1.24e-13	444	529	12	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	6.55e-174	25	529	28	534
KAF3763706.1|GH140	2.30e-166	15	528	18	535
KNX49908.1|GH140	1.32e-80	27	525	13	514
KAE8156220.1|GH140	4.12e-75	14	529	10	508
KAB8225539.1|GH140	4.67e-73	14	529	10	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	1.25e-23	25	528	13	444	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	4.29e-22	25	528	13	444	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PHPALM_4093-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000328	0.999633	CS pos: 21-22. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_4093-t46_1-p1.