CAZyme Information: PHPALM_3812-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_3812-t46_1-p1
• CAZy Family: GH89
• CAZyme Description: Glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803		87581.68	4.0806

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01001947:1-2703(+)

Full Sequence      

FTLTAQEPIATLDYDYEVAGLPYFVVSGVSNAPVDVEVKYSEQFSVLSTNFSDGPSQYAT
AIANSRRVETHRFTPNEIGLLVTSMLSQPGQRWQTLRLLSGESVTFEDVGFQASIEVIDD
LSTLPGKFSSSNTKYNEIWELGARAVSAACLDAGSQVSSWMSSWSASEENGTFVPGTRPG
VSYKAWNLSDYTLNFETQIIRAGVGFYIGYDITANRGSLMFHLSSEYPVDSTYVNVNTTL
FPASTVTLTYGFDFVNATDMISYTLGSYPVPFDVKEHVWYHVKLDVNSTAGNLMLWLDGQ
QVMNVTISDLGFSESQLLLLGYSTTGEGAIGFGGWQDQASFIRNVNATSLNDSSKVLYSN
PMTDESVVLPEFGVQSNTYGACLDGAKRDRYIWLGDFYHTTRIMGVANSKPEQITGTWEY
LINYQASNGQYPGLMVMTYETPMPTPEVFMFNAGTADAYLNFPDYDILGLIGFVSYMEYY
NDVEFAKAKWGSLSKATAWLISCQGSNGLIDVIKYVAVFLGSGTGTAVNAAAVQCLEGMS
KVAQVVGDENSAKEWINVAASIKAAINDLLWNDTLGNFAVDTSTPEVYGVAAIAFAIISG
VANETQIDLCVKSLENLRQGPGYLDTSDSDITTKISPNTNGFLLDALLQTGHTNEAAFLL
DNLWNAMISNESYRSGASWEYVSQSLEPGLKEFTSLSHPWGGAPTYVLTNYVAGIRPEEF
GFRHWIVNPLVSGLEITSVNATVNTPYGSLTASWELTDSDTLKVTITAPLGTEGIFEVTQ
HNSSTYQQNVNGTGETISFCVDL

Enzyme Prediction     

No EC number prediction in PHPALM_3812-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	353	775	9e-64	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	2.88e-10	425	712	76	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	5.47e-10	714	773	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD52401.1|GH78	6.47e-187	1	778	46	812
ATZ56607.1|GH78	2.67e-186	1	778	70	836
QMW40986.1|GH78	1.89e-172	1	776	47	806
QMW28911.1|GH78	1.89e-172	1	776	47	806
QRD85156.1|GH78	1.89e-172	1	776	47	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.38e-09	383	771	331	690	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KNB2|PLH20_FORAG	9.49e-06	540	783	653	883	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000006

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_3812-t46_1-p1.