CAZyme Information: PHPALM_37754-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_37754-t46_1-p1
• CAZy Family: GH78
• CAZyme Description: Pectate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	NCKW01020560|CGC1	46653.87	9.4073

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01020560:1669-2979(+)

Full Sequence      

MSFDIRRVTTLISLAFALALTQSCLTCATSVVTGTAPGFATGTTGGGNTKPVYPTSIKEL
TSYLSGNEPRVVVLKQQFKFVNTEGSTKEKGCRPKNNIDCMAKKNGFLGQDAIQPSWSKC
DGSKVDVTYDKAAMTPLIIGSNKTLVGEGIKGVLNGKGIMITGSNVIVQNIHITNLNPHL
IWGGDAITIRGNGNVAPTGIWIDHVKISSVGRQMIVTNFSGAKGLTISNSNFDGNTKYSA
TCDGRHYWGFLILGKQTEMSLLGNYIQKLSGRSPKIGGHDGEVSVVHAANNYFYDSNGHA
FDAATGGYVLAEGNYFDSIKMPNQPDPKGSLFVPRAPSDCQTKIGRACQLNVLTKSGSLT
SKSEDAVIKKISNLKARIASTKVNAAAKFVLATQNFGVGDLENTVDQSSPEQATQQPVEQ
QQQPIQQQQQPVQQQQ

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	127	317	1.6e-79	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	3.33e-40	126	316	1	186	Amb_all domain.
226384	PelB	7.67e-16	131	317	91	274	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.40e-12	130	316	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19256.1|PL1_4	5.28e-202	4	346	4	346
ACR19250.1|PL1_4	2.14e-189	30	416	190	576
ACR19253.2|PL1_4	4.79e-187	11	401	5	404
ACR19247.1|PL1_4|4.2.2.10	1.11e-128	4	403	2	400
ACR19251.1|PL1_4	1.11e-128	4	403	2	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	8.88e-91	32	372	3	334	Pectin Lyase B [Aspergillus niger]
1IDJ_A	7.41e-77	32	363	3	325	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	8.21e-76	32	363	3	325	Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	4.26e-92	38	361	29	343	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q5BA61|PELB_EMENI	4.25e-90	32	358	22	340	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|A1CFS2|PELA_ASPCL	2.31e-89	32	388	21	368	Probable pectin lyase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=pelA PE=3 SV=1
sp|A2QFN7|PELB_ASPNC	4.76e-89	14	372	5	354	Probable pectin lyase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelB PE=3 SV=1
sp|Q00205|PELB_ASPNG	2.30e-86	14	372	5	353	Pectin lyase B OS=Aspergillus niger OX=5061 GN=pelB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001360	0.998609	CS pos: 23-24. Pr: 0.9475

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_37754-t46_1-p1.