CAZyme Information: PHPALM_37530-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_37530-t46_1-p1
• CAZy Family: GH72
• CAZyme Description: Hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614		68061.10	4.9597

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01020453:3742-5678(-)

Full Sequence      

MAAIGKVNTHGYDGQSPYRGDDRAPLKTLVTKSNKKFWDSEYGESDATGLSLAESIALDI
NQMGVSAFVYWQALDSGAWGLIQSNPGDNWIGTPNPKYYVMLQYSRHIRPGMTILSTDDS
NTVMAFDTSSKLLVLVTVNSGDSASTVTFDLSSFTTVAGPITAWTTETSGTGALYKSSKA
NLSAITSTSCDGERFGQSNDSSNVTQLLDHFEKRLGSPQLIMTSTLEVPARPGQVTTEFL
QQVLGPLYPSERVVDFQWEPMNIGVIAEVVIFTVQFDLEGSNEAKTQRRFVGKFLRPEFP
FESMFAVESKFYNEFTTKAGDAAMKNSAAVVGFPFAIPTAIFTSNVLIVLMFVEAVKTFT
CVDGSPPHHIPMLVTKLAQMHARFWNHDGDGLATPAGIGSQLTGEEKRLQFPGCWKDYLD
DVVLENSDKTRLTALCQRLSHKADLLKEVHDIVDNGPSSLIHGDFHIANMLLPTDDTDEV
TWLLDWATCGRGNPLRDLAFFFIVSVQASHRRVQEATCLEMYHKALTAEKEDVCLPLDKL
HQQYKMCVLNQFVILVVYDSLSKSLAANAKTERLREELNVHFREVNHRACLSVLDNVSEK
DFELLECDNLASFI

Enzyme Prediction     

EC	3.2.1.164:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	2	183	1e-44	0.4232456140350877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397213	EcKinase	1.02e-09	376	526	122	284	Ecdysteroid kinase. This family includes ecdysteroid 22-kinase, an enzyme responsible for the phosphorylation of ecdysteroids (insect growth and moulting hormones) at C-22, to form physiologically inactive ecdysteroid 22-phosphates.
214734	CHK	1.37e-09	369	529	24	193	ZnF_C4 abd HLH domain containing kinases domain. subfamily of choline kinases
396281	APH	1.41e-09	359	537	75	239	Phosphotransferase enzyme family. This family consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include: aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation. This family also includes homoserine kinase. This family is related to fructosamine kinase pfam03881.
270703	ACAD10_11_N-like	1.73e-09	454	501	173	218	N-terminal domain of Acyl-CoA dehydrogenase (ACAD) 10 and 11, and similar proteins. This subfamily is composed of the N-terminal domains of vertebrate ACAD10 and ACAD11, and similar uncharacterized bacterial and eukaryotic proteins. ACADs are a family of flavoproteins that are involved in the beta-oxidation of fatty acyl-CoA derivatives. ACAD deficiency can cause metabolic disorders including muscle fatigue, hypoglycemia, and hepatic lipidosis. There are at least 11 distinct ACADs, some of which show distinct substrate specificities to either straight-chain or branched-chain fatty acids. ACAD10 is widely expressed in human tissues and highly expressed in liver, kidney, pancreas, and spleen. ACAD10 and ACAD11 are both significantly expressed in human brain tissues. They contain a long N-terminal domain with similarity to phosphotransferases with a Protein Kinase fold, which is absent in other ACADs. They may exhibit multiple functions in acyl-CoA oxidation pathways. ACAD11 utilizes substrates with carbon chain lengths of 20 to 26, with optimal activity towards C22CoA. ACAD10 may be associated with an increased risk in type II diabetes. The ACAD10/11-like subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).
270690	APH_ChoK_like	1.66e-07	419	502	79	153	Aminoglycoside 3'-phosphotransferase and Choline Kinase family. This family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves as precursors to the synthesis of important biological compounds, such as the major phospholipids, phosphatidylcholine and phosphatidylethanolamine and the amino acids, threonine, methionine, and isoleucine. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26121.1|GH30_5	3.03e-77	1	183	295	478
ATB44315.1|GH30_5	2.68e-54	2	195	297	480
QRN98147.1|GH30_5	1.33e-51	4	175	300	468
ADO68177.1|GH30_5	2.55e-51	4	175	300	468
EAU67098.1|GH30_5	2.55e-51	4	175	300	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IUJ_A	6.48e-06	7	167	274	439	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	7.04e-06	7	167	345	510	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q76FP5|6GAL_HYPRU	1.27e-32	4	177	278	448	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997960	0.002049

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_37530-t46_1-p1.