CAZyme Information: PHPALM_37459-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_37459-t46_1-p1
• CAZy Family: GH72
• CAZyme Description: Pectin lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460		49835.49	6.6903

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01020425:92-1474(+)

Full Sequence      

MSRIGFAIVAALALAVSSTNAFTIGSPTGLAAGTTGGANGTVVYPKTNKELITYLNSTEP
LVVVLNKTFDFRGTEGKTTEIGCRPQTARECIAANNGFKSQDVILRNGMNNTGGCENGTE
TTVTYDNAFRWRMNVTSHKTIRGIGRRGVIMGKGITLRGDNIIVQNIHITELNRHLVWGG
DALYMEGTVNGTKTMNNIWIDHVKVSRVGRQMLVTNKAGVATMTVSNSDFDGETDYSATC
NGRHYWTILLYGKNTGVSLLNNYVHSTSGRSPKVGDKNSSVIAHVANNYWDNLSNHSFEL
DGNAWMLAEGNYFNNVENPLYKSGKGFLYAASSEDECMKYLGRACEENTLVSSGNFTSRD
GTLALEAMKKYPAITGYAPGSGQSTSSKQQSTDDSANQSEEQTSSPVQQSEQLSLTLPIV
KEYTPGTLKTTQSEQESVDTSGLEKIWKETTSNFGVGNLD

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	122	315	4.7e-77	0.9946524064171123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	7.66e-31	122	316	3	189	Amb_all domain.
226384	PelB	4.10e-16	18	320	25	280	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	2.57e-04	134	313	31	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74069.1|PL1_4	1.40e-185	1	460	1	441
ADN18835.1|PL1_4	5.67e-185	1	460	1	441
AHX74068.1|PL1_4	8.64e-172	8	379	8	381
ADN18834.1|PL1_4	3.49e-171	8	379	8	381
ADN18833.1|PL1_4	2.73e-158	8	379	8	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	3.94e-73	25	362	5	326	Pectin Lyase A [Aspergillus niger]
1QCX_A	3.07e-72	24	363	4	329	Pectin Lyase B [Aspergillus niger]
1IDJ_A	1.45e-69	25	362	5	326	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	3.78e-87	1	358	1	343	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	2.92e-85	25	363	26	351	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	2.92e-85	25	363	26	351	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	1.30e-83	8	360	8	347	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	1.30e-83	8	360	8	347	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999766	CS pos: 21-22. Pr: 0.9803

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_37459-t46_1-p1.