CAZyme Information: PHPALM_37355-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_37355-t46_1-p1
• CAZy Family: GH7
• CAZyme Description: Glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		41855.59	4.2318

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01020381:69-1250(-)

Full Sequence      

MVRVFALSAAAVAMMASSTSALDQKLYGLNYDLRQGPDWDPSKCKSADTIAADLKILSTI
TSNVRTYSLSDCDVSGVLTAAKELSLTVWLGVWVSEDETVYDNEVKAFKKLISAGLIDKN
VVGINVGSEAVYREDITAEKAIEYVTDFKKVMADNDISVPVSITDIIDTFVQYPDMLKAG
DIVTINQFPFWEKIEADKAAAQFNKRIQPLFKLAGDMEVIISETGWPTGGTATNGSVASE
ENGAVYLNDFYQLAESKGWKYYYFAGFDTPYKEEQADDATTVESHFGIFDDKGTMKTAYE
SLKFTKNGDLSASGSSITTSSGSSSTSVGAGTVAPGSGTSTGTSGTYTTSSGSSNTNTAS
SSSINKEESGSSQLVAAGLAACLGVVSTMFWNL

Enzyme Prediction     

No EC number prediction in PHPALM_37355-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	43	296	3.9e-22	0.9453376205787781

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	9.19e-41	36	289	51	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.03e-16	28	296	2	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56146.1|GH17	3.60e-82	1	318	1	313
AIG55390.1|GH17	2.57e-80	7	306	7	313
AIG55438.1|GH17	1.14e-79	1	318	1	324
AIG56392.1|GH17	1.45e-79	3	306	2	310
AAY53769.1|GH17	8.37e-70	11	306	9	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.42e-36	24	288	35	281	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.77e-35	24	288	35	281	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QN74|BTGC_ASPNC	4.92e-22	46	296	401	670	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2
sp|Q0CI96|BTGC_ASPTN	1.54e-21	22	313	354	655	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2
sp|P43070|BGL2_CANAX	1.87e-21	40	296	31	300	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|P15703|BGL2_YEAST	5.19e-21	6	311	8	313	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|A1CAI0|BTGC_ASPCL	9.46e-21	46	297	412	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000305	0.999666	CS pos: 21-22. Pr: 0.9670

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_37355-t46_1-p1.