CAZyme Information: PHPALM_36879-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_36879-t46_1-p1
• CAZy Family: GH6
• CAZyme Description: Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574		63571.79	6.2902

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01020234:6198-8142(+)

Full Sequence      

MAMNAKQSAALIALAREKKLFLMEGMWTRFFPSIRFVRKLLNDHEIGEVRHVHAEIGYPF
PKDEARLWKNELGGGGLLDIGIYPLAFATMVFGTEPEKVTSTGTLNDGGVDVHNSVTLHY
SDLRFATIEYSMLVQLSETVTISGTTGRIHIHTPAHLATEVSVIRSVGPGKEESKTTQFA
WPDADNGYSGFLHEGEAVTKAIQTNQLEAEEYSLDESLGIMTIMDKIRKDIGLVSVLDVI
PVLVALDTLVIMTSINTRPLRWGILGCGRISHTFASNVKPLETAIFHACAARSLDKAQEF
ATKHNIPHAYDSYEALCSDLEVDVVYIGTIHPTHCKLALLALNHGKHVLVEKPMAMNVKE
AEAVIKLAQQKHLFFMEGMWARFFPAIRFVRQLIDQGGIGDVHHVHSAFGVPFKGDNDRI
WKKELGGGGLLDIGIYVIASATMVLGFEPENVTSAGKLNDKVEYSTLTKLSETVTISGSK
GRIFIQPPAHATMEISVVTYDEFGKETEKTLRFPWPNPNDHHSGFLYEAEAVTEAIHNNQ
IERSEYSHAESLGIMKIMDQIRHNLGLVYTADTP

Enzyme Prediction     

No EC number prediction in PHPALM_36879-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	260	409	6e-20	0.39598997493734334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223745	MviM	1.14e-52	257	563	1	330	Predicted dehydrogenase [General function prediction only].
275173	myo_inos_iolG	5.51e-25	259	407	1	150	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]
223745	MviM	8.67e-24	1	232	100	333	Predicted dehydrogenase [General function prediction only].
396129	GFO_IDH_MocA	1.54e-20	260	379	1	120	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
183212	PRK11579	2.08e-10	260	409	5	152	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO12039.2|GT4	1.55e-13	260	573	2	332
BDF54821.1|GH109	1.98e-11	283	409	85	219
QRO51930.1|GH109	2.49e-11	283	409	69	203
QUB43953.1|GH109	4.98e-11	252	424	39	219
QUB77029.1|GH109	6.84e-11	252	424	54	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O48_X	9.46e-48	260	572	3	332	Crystal structure of Mammalian Dimeric Dihydrodiol Dehydrogenase [Macaca fascicularis],2O4U_X Crystal structure of Mammalian Dimeric Dihydrodiol Dehydrogenase [Macaca fascicularis],2POQ_X Dimeric Dihydrodiol Dehydrogenase complexed with inhibitor, Isoascorbic acid [Macaca fascicularis],3OHS_X Crystal Structure of Mammalian Dimeric Dihydrodiol Dehydrogenase in complex with Dihydroxyacetone [Macaca fascicularis]
3E9M_A	2.57e-31	260	559	6	313	Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]
4HAD_A	1.60e-27	260	449	24	214	Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_B Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_C Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_D Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42]
3EVN_A	9.51e-27	260	428	6	174	CRYSTAL STRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]
3RBV_A	1.77e-24	256	452	24	220	Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata incomplex with NADP [Actinomadura kijaniata],3RC1_A Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata incomplex with NADP and TDP-benzene [Actinomadura kijaniata],3RC2_A Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP; open conformation [Actinomadura kijaniata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q642M9|DHDH_DANRE	4.51e-62	260	573	3	333	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Danio rerio OX=7955 GN=dhdh PE=2 SV=2
sp|Q6DKE0|DHDH_XENLA	3.74e-56	261	569	4	329	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus laevis OX=8355 GN=dhdh PE=2 SV=1
sp|Q6DF30|DHDH_XENTR	1.05e-54	261	569	4	329	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus tropicalis OX=8364 GN=dhdh PE=2 SV=1
sp|Q148L6|DHDH_BOVIN	9.28e-52	260	572	3	333	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Bos taurus OX=9913 GN=DHDH PE=2 SV=1
sp|Q9TV69|DHDH_PIG	3.57e-49	260	572	3	333	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Sus scrofa OX=9823 GN=DHDH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

Start	End
231	253