CAZyme Information: PHPALM_36227-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_36227-t46_1-p1
• CAZy Family: GH53
• CAZyme Description: Pectinesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		37561.83	5.7309

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01020114:98-1132(+)

Full Sequence      

MRVYALPLVVLASLVSTTVGYACTGPDTRTVPPAGSTVVDASGVYAGSFRNISEAVAHLP
NTTEQHTLFLFPGVYHEQVLISKLNGPLVLQGYTCNTTSYAANEVTITHAKAQRDIPPEI
TSGRNDLTSTLRLKTNNVRVYNLNVANTAGKIEKDGQAVATIIEGNNYGFYACNFTGYQD
TVYANKGRELFAKSYIAGAVDFVFGSKAEAWFESCDIETVGEGCITANGRVNESSPSYYV
FNNARVFGSSGNGSAYLGRPWRPYSRVVWQNSELGDVINPEGWQQWNKDNNTANVYYKEF
NNRGPGAAIDKRVPFSGQLSAPVDIKEILGGNYTNEWFVDNAFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	39	320	2.3e-78	0.9340277777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178113	PLN02497	6.31e-49	34	321	31	308	probable pectinesterase
178051	PLN02432	2.01e-48	39	332	15	289	putative pectinesterase
395871	Pectinesterase	1.02e-46	38	317	3	276	Pectinesterase.
215357	PLN02665	6.76e-46	47	320	78	341	pectinesterase family protein
215173	PLN02304	1.48e-45	26	320	69	355	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ63096.1|CE8	4.62e-229	1	344	1	344
ACO54873.1|CE8	1.32e-228	1	344	1	344
ACO54871.1|CE8	1.09e-205	1	343	1	343
ACO54870.1|CE8	1.20e-169	1	344	1	347
ACO54874.1|CE8	8.34e-168	1	344	1	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	9.36e-58	27	343	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.32e-57	27	343	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	2.81e-33	38	317	10	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	7.29e-33	47	317	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	1.07e-73	29	344	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	4.24e-73	29	343	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|Q4WBT5|PMEA_ASPFU	3.82e-66	29	343	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	3.82e-66	29	343	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	1.37e-63	29	335	29	319	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.016932	0.983032	CS pos: 22-23. Pr: 0.5163

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_36227-t46_1-p1.