CAZyme Information: PHPALM_3538-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_3538-t46_1-p1
• CAZy Family: GH53
• CAZyme Description: Hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	NCKW01001884|CGC1	31871.26	4.5350

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01001884:6411-7362(-)

Full Sequence      

MTSIVAMIAIIAVSVEYVQSHGYVEIPEAEFKNKKTSEWIVQIDPQWKGDWNNVKGDEGL
VALYKELKASNKAKDIRTLLDSDTKLYGADCGYTNPDAKPKDPPKDGTAKFSRGIGHAGP
CEIWLDDKMVLQNDDCQGAFGDGTVEYTSIFKPIDYSSCASGGCMFRFYWMALQRLDGKT
MWQIYKNCIPLSGPAGGGAGQLDPSISGGSNTSQKASSTGDEDADLQELGGSNKTSSTDE
EDVSQTSPASPSNGDSGSPSTPATPPPESDNTAPSPDTPEMAPAPSSKCNGRRRRRY

Enzyme Prediction     

EC	1.14.99.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	8	271	2.6e-63	0.9061224489795918

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
369011	XRCC4	0.007	199	295	205	278	DNA double-strand break repair and V(D)J recombination protein XRCC4. This family consists of several eukaryotic DNA double-strand break repair and V(D)J recombination protein XRCC4 sequences. In the non-homologous end joining pathway of DNA double-strand break repair, the ligation step is catalyzed by a complex of XRCC4 and DNA ligase IV. It is thought that XRCC4 and ligase IV are essential for alignment-based gap filling, as well as for final ligation of the breaks.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETK78976.1|AA17	6.79e-133	3	295	6	275
ETL85650.1|AA17	3.91e-132	3	295	6	275
ETI38761.1|AA17	7.88e-132	3	295	6	275
ETN19254.1|AA17	7.88e-132	3	295	6	275
ETM38805.1|AA17	1.12e-131	3	295	6	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	3.04e-88	21	193	1	172	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

PHPALM_3538-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999767	CS pos: 20-21. Pr: 0.9783

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_3538-t46_1-p1.