CAZyme Information: PHPALM_3537-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_3537-t46_1-p1
• CAZy Family: GH53
• CAZyme Description: Hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	NCKW01001884|CGC1	34152.19	4.4465

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01001884:3369-4346(-)

Full Sequence      

MVSSTSILAMVAAVATTVNYVEAHGYIAKPAPSWKDKETNDWVVEIEPQWKGGWDESKGD
PGLLSTFKELAAKNNYKDVRTLMDGNPVYGEDCGFTDPKGTPVDPPTDGTATFSRGIVHA
GPCEIWLDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKG
KTVWQAYKNCIPLTGPAGGGAGQQDPSQQTGGGSDTSQKTPSTGDEDVSQTSPASKSDGD
ASKSDGNASKSDGNASKSNGDGSKSDTPSNDDASKSDTPSNGDSGSPSTPATPPPESENT
APSPDTPEMAPAPSSKCNGRRRRRY

Enzyme Prediction     

EC	1.14.99.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	11	270	1.2e-63	0.9020408163265307

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
411525	agg_sub_LPXTH	0.001	207	307	66	167	serine-rich aggregation substance UasX. Members of this protein family are repetitive, serine-rich surface proteins of the Firmicutes, found primarily in the genus Leuconostoc. The variant form of sortase signal, LPXTH, is replaced by LPXTG in members from some lineages, such as Weissella oryzae, and therefore recognizable. Some members of this family have the KxYKxGKxW type signal peptide as seen in the glycoprotein adhesin GspB, a substrate of the accessory Sec system for secretion. WOSG25_050600 from Weissella oryzae SG25 is identified in a publication as an unnamed aggregation substance, a conclusion supported by the sorting signals and composition reported here. We assign the gene symbol uasX (unnamed aggregation substance X) based on our evaluation of the family.
411414	MSCRAMM_ClfB	0.009	205	303	581	681	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETK78975.1|AA17	1.39e-151	1	325	1	326
ETI38760.1|AA17	5.65e-151	1	325	1	326
EEY68486.1|AA17|1.14.99.-	9.47e-143	1	229	1	224
EGZ23516.1|AA17	1.05e-142	1	323	1	319
ETN19254.1|AA17	4.08e-115	1	323	1	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	1.57e-121	24	195	1	172	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

PHPALM_3537-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.036078	0.963894	CS pos: 23-24. Pr: 0.8923

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_3537-t46_1-p1.