CAZyme Information: PHPALM_31057-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_31057-t46_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
655		73956.80	5.8263

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01016933:8805-12994(+)

Full Sequence      

MSKVFDHAAHAQHRWRRFLNHDSKNYAGFSVMAGRLQFAKVVSSHKRAKGIAYLTKKTAE
KLPKLMVYPLVLGVTGAELLVWGTSYFNDGKDNDTSKVARDAKLAPAAFAVYGTTLNSVY
PLVGRWRRVRGWLRPIKWGAIAYNSDPTQFIFLVSSGTEDVNNNGIYATANITAIDQLVL
SPQTTDVWIQGGDYQQINKGKIVELELAPDLLTSQSQVKSVSLMSMNLSAKSYDIPYMIP
NSTTTLSLSNTLLTEFPSHFSSLSNIMILHLNDNYISTVGPLVNWEKLVVLDLHQNSVST
FEGNFPGLTELYLNINNLTEIPAVVFTFEHLTKLVIQNNPLTSRSFTESQITFLQGLTSL
DLVDSDFHIAVNCSRAEQRSIEDESLASIENKEWSTKPNDDELNGQEIFELTNQGDEQEG
SVSKDKGIIMCLHNGAVPLGLSLVRELRCLGNKEVIQIYHCFPEEMSNASRALLLEADKN
LEIVDVCTDLVAKGKLTEDRARHFRSWWIKPLAMYHTDIKEVLLLDIDDIFMRDPAALRT
TEGYKRTGTTFFYDRVLSSTEFFNQNVDGEQYLKKLLNEFDYAKYGLPPGSTPSDHLNIN
TSYAWRRQTSHEQDSSLVAIDKSRAGQAMEIMFFLITEQHFVHEFSYGDKETFWI

Enzyme Prediction     

No EC number prediction in PHPALM_31057-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	426	655	7.6e-42	0.8446969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.26e-20	426	655	2	231	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
275378	LRR_1	1.41e-16	243	343	1	109	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
275380	LRR_RI	1.22e-13	244	343	122	229	leucine-rich repeats, ribonuclease inhibitor (RI)-like subfamily. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
275380	LRR_RI	2.93e-13	244	362	50	174	leucine-rich repeats, ribonuclease inhibitor (RI)-like subfamily. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
275380	LRR_RI	4.73e-13	243	362	1	126	leucine-rich repeats, ribonuclease inhibitor (RI)-like subfamily. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAP68847.1|GT71	6.51e-80	421	655	58	299
CCA15193.1|GT71	4.27e-75	422	655	128	366
CCA22801.1|GT71	5.99e-63	427	655	60	285
AIG56397.1|GT71	1.01e-48	426	655	92	321
AIG56246.1|GT71	3.76e-41	426	655	65	314

PDB Hits     

PHPALM_31057-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53745|MNT4_YEAST	3.05e-11	426	655	198	430	Probable alpha-1,3-mannosyltransferase MNT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT4 PE=3 SV=1
sp|Q5AGA9|MNN13_CANAL	4.45e-10	423	655	329	574	Putative alpha-1,3-mannosyltransferase MNN13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN13 PE=2 SV=2
sp|Q59VL7|MNN15_CANAL	6.30e-08	423	655	262	517	Putative alpha-1,3-mannosyltransferase MNN15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN15 PE=2 SV=2
sp|P53059|MNT2_YEAST	3.35e-06	423	655	172	404	Alpha-1,3-mannosyltransferase MNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_31057-t46_1-p1.