CAZyme Information: PHPALM_29325-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_29325-t46_1-p1
• CAZy Family: GH43
• CAZyme Description: putative beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		46770.94	4.5534

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01015867:1563-2907(-)

Full Sequence      

MFARRAWLWVGACAAVVVSGVHALTKGHDLSSAPLMEKEQGTIWYDTTGKQAAIEDILGK
GGMDSVRLRLWTGEEYGLNYTLTLAQRFSKKGYKIFLDLHFSDTWAQPSDQQTPSAWDNS
SVETLASACRDHVSSTLKAFTEGGVELDILSIGNEITDGFLYPTGKISNDDFGPFAKLWK
AARDGVTDAVQTGTTRPKVMIHLDNGWKYETVSWFFKGLFAEGSVTIDDVDAFGFSFYPY
YNVNATLDALTSSLTQMANTYKKPIYVAETDWPTNCTTVTLSEKYRVSARGQREWVMAIM
DVLEGLPNGLGAGIFYWEPGYISVPGLGSACGSNLLFNVNWDNWPDTYANALSSVYMFAD
RGSSQGGNGSATQSATTSTTAPIPQVQTDSSQPTQLNFSQLDQTSSSTKQTEDDSTQQTS
EGSTKRQ

Enzyme Prediction     

EC	3.2.1.89:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	26	339	2.2e-79	0.9619883040935673

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
311610	Glyco_hydro_53	4.36e-85	26	358	2	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
226385	GanB	8.79e-60	26	358	41	378	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO16178.1|GH53	2.43e-97	26	358	39	394
USW53574.1|GH53	3.41e-95	26	358	29	386
CCA76188.1|CBM1|GH53	2.96e-93	26	358	93	420
AAQ77827.1|GH53|3.2.1.89	7.21e-88	23	340	18	329
ATZ54814.1|GH53	1.65e-87	26	358	30	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BF7_A	6.29e-74	23	341	18	335	Emericilla nidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1FHL_A	4.53e-72	23	342	1	322	Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]
1HJQ_A	3.71e-70	26	358	5	329	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1HJS_A	1.95e-66	23	358	1	329	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1R8L_A	5.13e-36	18	349	17	352	The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Y7F8|GANA_ASPTU	5.83e-83	23	360	17	349	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1
sp|Q8X168|GANA_ASPNG	4.62e-82	23	360	17	349	Arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger OX=5061 GN=galA PE=1 SV=1
sp|A2RB93|GANA_ASPNC	2.59e-81	23	360	17	349	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=galA PE=3 SV=1
sp|Q5B153|GANA_EMENI	3.05e-73	23	341	18	335	Arabinogalactan endo-beta-1,4-galactanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=galA PE=1 SV=2
sp|P48842|GANA_ASPAC	3.73e-71	23	342	17	338	Arabinogalactan endo-beta-1,4-galactanase OS=Aspergillus aculeatus OX=5053 GN=gal1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.105761	0.894215	CS pos: 23-24. Pr: 0.8265

TMHMM  Annotations     

Start	End
7	25