CAZyme Information: PHPALM_28380-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_28380-t46_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1690		192527.18	7.4490

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01015563:3658-9737(+)

Full Sequence      

MASPSLHARSIRHIKRYTTTPTPPNSPRNGPRIGILTLFSVIGLYALGFVVWGMCRSVVS
SDSSNGDDVRLSSKLIRQLRRRERAINDGIVADRKWMEQLLQGDRPPDLRCKGWKQTDSC
DIQDEVPAKNRGCDQFVRGGIGGYCLMEDEDTGQQIQVMHTACDTLHPSVTISCRHAGDF
VDFQWEIAQLTATIEREKETANFEGSLTSSTRSKGILMVIYPKLLVSAYASIRALRAVNC
TLPIELWYIESEMNTDSGASLLDDIPKKLQEEFGPLTLHSITDPRVAGFNSKVYAITHTE
FEYVLFLDADNVPVKDPSYLFESREFLQMGAIFWPDFWHPTHTIFNINEQSLLWELLNMP
YTDMFEQESGQLVIDKTRSTAALRMLSLFAFHDPNLFSRYKLVHGDKDLFRLAWLKTKTP
FHMVANPPGIAGTVRESKFCGMSMVQFDTDGEVLFLHRNAKKLTGGLDSSRKPDEQIWTH
LQRFRYRASSPHDREVEAAFEAARPSLAPNETIDSPHVPVGNLNMPYSVLRQKYSIQIFN
GAPEFDETQWCYGQALITAPRYKTIAWEDTVFPNVERNLLQYANEAVVLLPESAVEYIVQ
HDREEASFHFKANASISKYFTSLSTCINPLFLYTCIAFYLGCLLFWWLFLKGDANRVRIS
RLSSAILPSRSTFDASLYNAESDGADNLLTTFARGIGATTPELLELHRKHHIPDYKCVGW
RQTSNCSPDGPRVSQKDLSCGGTVTAGASGYCLLKNEATGEEIQAMRLSCNSLRNRTTFK
CSQAVDFARVAPQVNALIASKTKETVEGEKQLRRGEVRNDTEAVVTRGIVMVVYPKLLNS
VHVTVRLLRGFGCKLPVELWFLKSEMGAVPLDYSRILQSLVKDYGPVALKGISDDLVVGF
TSKVFALAHSEYDQILFLDADNVPVKDPTYLFDTPEFLDIGSVFWPDFWTPTNTIFNIKA
ESLIWELVGTPFVDMFEQESGQLLIDRRRTAVALHVAQFLAMREPRHLERLRLSYGDKDL
FRLAWLKTNTSFHMIVTPPAAAGMVREKQYCGMTMVQHDTRGEVVFLHRNGKKLSGEEDF
TRDHTWGHLQTFVFPKQLASVDADPEERYSFVKKYFQVEIFKGGKEFVKTRMCYGDRFLK
SEHFQLTPWKDLPWRNIEDTLLDYARKKSWKHYLLGVLLLSNLLYVCIIITRSPETIQAN
FSTIAVQQESSLMLRTDTISMSPPDNFIDFTWNTSSPRRLKCLGWRATKGCNPDGARIPN
KDLSCSKKIPRGSSGYCVIEDEDTHEKFRVMKKTCSKGKPGAIFQCSDAPGFANFRVEAQ
SAIDKALTPGFALPNVNISRQNLQRGIAIVVHPGLVASAYATIRVLRDTLGCRLPIEIWF
RPNEMRQNPDGLDTLKRLAKNDTAGQITLEEIDHPEAIRFNTKIHAIYHSKFDEVLFLDA
DNVPVKDPSYLFQTSEFVKTGAIFWPDYWHPDHTIFFVNKESLVWELLDTPFVNMFEQES
GQVLVDRRRHAAALELVMFYGFHKPNYFDRMKLVWGDKDLFRLAWLKLGASFHMIHTPPS
VAGRMFGLSFCGMTMVQHDTNGEVLFLHRNQMKLTGKPSDDLSSELQKFIDEFPGPIMWT
HLVSFKKSSTRSEYVIQTHVEHKFSKQRRCFGRQFPDKSSSFYIHEIEDLAFAGIETHLR
RFAMEATTHR

Enzyme Prediction     

EC	-	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	214	448	2.6e-52	0.9924242424242424
GT71	1345	1579	4.7e-52	0.9924242424242424
GT71	827	1059	1.4e-44	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.43e-41	213	448	1	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
402574	Mannosyl_trans3	3.03e-40	1345	1579	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
402574	Mannosyl_trans3	3.28e-29	827	1059	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	3.01e-05	1410	1476	59	142	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133018	GT8_Glycogenin	2.37e-04	904	957	84	129	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24059.1|GT71	8.39e-189	711	1686	137	1173
UIZ28119.1|GT71	8.82e-117	1349	1686	1	354
UIZ24000.1|GT71	2.12e-91	1240	1687	104	568
CCA25989.1|GT71	3.76e-90	711	1163	92	534
UIZ28362.1|GT71	1.17e-82	109	502	666	1057

PDB Hits     

PHPALM_28380-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38069|MNN2_YEAST	2.52e-15	1346	1579	172	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q5AP90|MNN23_CANAL	1.03e-14	213	446	173	447	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2
sp|P46982|MNN5_YEAST	1.85e-12	1359	1594	164	448	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|A6ZQE9|MNN5_YEAS7	2.43e-12	1359	1579	164	433	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|Q5AD72|MNN24_CANAL	6.88e-10	1362	1555	310	532	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000007	0.000028

TMHMM  Annotations     

Start	End
33	55
627	649