CAZyme Information: PHPALM_27393-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_27393-t46_1-p1
• CAZy Family: GH30
• CAZyme Description: Glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323		36471.98	5.0490

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01015009:1-968(-)

Full Sequence      

MKILLQVAAALSLVAAANPVDHVLDTTLGGDNTNDLPVIKDAKWYWENDHVFTSEHLDFF
ENFKPHDENQTCSSDRHATPFNKQVRGANLGGWLVLEPWITPTLFYQFLSTQERFGDKAP
EKTAMDMYTFCTALGKEEANRQLRIHWATWVTEADLKEMAEAGVNSLRVPVGDWMFNPYE
PYIGCTDGAVNELDRVANLALKYNIDLLLDIHGLIGSQNGFDNSGMASSVKWTSIASTRP
IGTTTFEHWPLRSAGWAGEFNSTTNTYKSINYEHLNHSLATVAAIVNRYANHPAIIGLEP
VNEPWELTPIDLLKDYYWKSYKR

Enzyme Prediction     

No EC number prediction in PHPALM_27393-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	142	323	8.3e-98	0.6510791366906474

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	5.49e-18	85	304	18	191	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEY55816.1|CBM43|GH5_33	1.64e-219	1	323	1	326
EGZ13976.1|CBM43|GH5_33	8.91e-212	1	323	1	324
EGZ04731.1|CBM43|GH5_33	5.53e-181	4	323	6	317
UIZ22001.1|CBM43|GH5_33	5.47e-163	38	323	18	304
EGZ13975.1|CBM43|GH5_33	6.76e-159	35	323	54	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.33e-35	82	239	6	156	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	4.97e-35	82	239	6	156	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
4M80_A	5.41e-35	82	239	11	161	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
3N9K_A	5.41e-35	82	239	11	161	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
2PF0_A	5.50e-35	82	239	12	162	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	8.14e-39	82	234	34	175	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|O93939|EXG1_WICAO	1.27e-37	82	321	39	237	Glucan 1,3-beta-glucosidase 1 OS=Wickerhamomyces anomalus OX=4927 GN=EXG1 PE=3 SV=1
sp|Q5AIA1|EXG2_CANAL	6.81e-36	73	321	30	244	Glucan 1,3-beta-glucosidase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EXG2 PE=1 SV=2
sp|Q12626|EXG_PICAN	1.86e-35	82	322	46	242	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	3.07e-35	72	232	19	163	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000274	0.999668	CS pos: 16-17. Pr: 0.9537

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_27393-t46_1-p1.