CAZyme Information: PHPALM_2621-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_2621-t46_1-p1
• CAZy Family: PL3
• CAZyme Description: Hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385		43025.04	5.9375

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01001191:588-2003(+)

Full Sequence      

MQENSRRRWGTPHVTPLHGLSVSTYMRASGVHWSIPVEVIPAKDHGGCYYSYGYLTPGAN
NIDVPTAYYQQKRGHKSWYQGLQYASNNECMQNTSLQQSYSTIAASMKAGITGNSCTLKT
CPASYDVHSDLGLIDGEGTNHWGINTNGTCFPVMNSYTGAYLCDPDNTNLKCTSPRNSST
PKSSAMSSFNYQMDAISSNWPVHVGAYLDFVVYQVEWVTGKNGYVRWMLHGSPLFEVPAT
SVVDIPQNSKKTNPQKLMLEEPMYVIFNVAVSATWGAKPPNPGQECRGDGNDPVVNKICD
DFPMYMKVDCIRLYQDLGDDLESDNYMQIGCDPKNHPTKKWIEGHIDEYEDNDNKRNSST
PKSSAMSSFNYQMDAWNAVVMEMTQ

Enzyme Prediction     

No EC number prediction in PHPALM_2621-t46_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	1.31e-14	210	367	364	498	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	1.11e-11	191	315	188	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	1.56e-08	209	314	159	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28149.1|GH16	1.70e-161	48	354	299	605
UIZ28152.1|GH16	2.03e-156	42	354	282	593
UIZ27810.1|GH16	5.86e-155	48	354	338	644
UIZ28151.1|GH16	7.24e-152	48	363	302	617
UIZ28150.1|GH16	6.10e-149	42	355	232	544

PDB Hits     

PHPALM_2621-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

PHPALM_2621-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000003

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_2621-t46_1-p1.