CAZyme Information: PHPALM_2482-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_2482-t46_1-p1
• CAZy Family: GH30
• CAZyme Description: Glycosyl hydrolase family 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		35686.48	7.9568

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01001041:1093-2043(+)

Full Sequence      

MKFLGKTKGTAAFENHRQTWITEADIKEIAATNVLNTVRVPVGHWIIRDATTSPGTEADV
FAPGGLKYLDTLINSWAVKYNIAVIISLHAHQGSQNGYEHSAPATIGKVGWSTLQTNIDN
SLKFATFLAARYRNSPAFLGLALMNEPTPPVDRTILQNFYIEAYKQIRATGNMCILFVTP
FLSEQDADHLRGMIGAPQYVNVWNEIHAYFIWGYAGKTEQQILAEIDNYDQTHLKAAPTN
NRLFLGEWCMGGPPDQTGIFQNLDNFRELGRKQLAYYNADITGGWAFWTWRHSDESIKRT
GWSMRYLIRSGYLKLS

Enzyme Prediction     

No EC number prediction in PHPALM_2482-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	14	295	1.1e-45	0.9711191335740073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.78e-19	4	308	57	376	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	3.95e-07	16	290	20	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29723.1|GH5	1.99e-91	1	316	50	363
AAM18484.1|GH5	8.78e-89	1	315	58	370
CCA15900.1|GH5	5.09e-88	1	315	151	454
CCA15861.1|GH5	7.45e-88	1	315	61	374
AIG55478.1|GH5	8.52e-79	1	315	64	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	1.24e-10	11	147	45	168	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	2.99e-10	11	147	45	168	Chain A, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	1.66e-24	4	313	76	403	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	1.22e-23	4	311	83	388	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|B8NBJ4|EXGB_ASPFN	1.48e-23	4	316	81	391	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgB PE=3 SV=1
sp|Q2TZQ9|EXGB_ASPOR	3.22e-23	4	313	81	388	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgB PE=3 SV=1
sp|Q4X1N4|EXGB_ASPFU	1.94e-22	4	291	80	367	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_2482-t46_1-p1.