CAZyme Information: PHPALM_2267-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_2267-t46_1-p1
• CAZy Family: GH30
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574		63986.10	4.9919

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01000841:808-2532(+)

Full Sequence      

MSVNESSPLLQSHLGQPRGRPLRRALYVIVPLALVAVATICILIASDGHSTPAPEPTAAP
PVVELTDAELLTMRPPFIEKLHPIPPKLVRRNAFGRSLPTNEFWSNLLVADGHGLNVGGG
EVTLSPYTVRSLPKRLDISYGDSRRVATTTAVTEYFNVDASFTAYSRKALNDNETASALL
GDGNSTSRNVVTFDVLSVLLQYYYGEDNKWMKVPMVRGSPYVTVEYQNVLPVLEFNATVL
AINGEQVQQKDPLAPWNELQTWTNSRFELDIEVYSAGESAHGTGKAQQKWILYFDKVRTL
QLQFANEKDYRPYNWRGELTTPTNIRLVDTDFYTGTARLAIVPQGAPHTVVDALDKAAAI
YPVSSSITTDVGDTKASFSFCWKTKRFPDLGEPNLNSTSTAELLMLANPHHAATLKEDSD
AFQVLGQFGHRTLKSNMTAVLGSCWELQEALPTASFQEENVQIQPQYLEAIRVALANDSN
YTPEADDPYYFGKEIGRQARLVLIADKLGENEFRDDMLDKLEEWLTPWMLGQNSDHFVYD
RSWGGLCSLNGLKGVFWMTDFGNGWYNDHVRTST

Enzyme Prediction     

No EC number prediction in PHPALM_2267-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	82	569	2.5e-63	0.6077170418006431

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	3.94e-28	72	569	63	510	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	9.43e-27	82	453	1	312	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
407548	Glyco_hydro81C	7.79e-13	468	569	7	112	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24045.1|GH81	0.0	1	569	1	568
CCA19047.1|GH81	1.27e-148	5	569	9	572
AGP40408.1|GH81	6.67e-41	67	569	50	463
AUX36386.1|GH81	3.33e-40	67	569	61	474
AUX46944.1|GH81	1.14e-39	99	569	92	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.20e-23	77	569	21	476	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.24e-23	77	569	46	501	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.16e-22	77	569	21	476	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT45|ENG1_SCHPO	2.52e-11	82	569	66	493	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999978	0.000033

TMHMM  Annotations     

Start	End
26	48