CAZyme Information: PHPALM_18372-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_18372-t46_1-p1
• CAZy Family: GH16
• CAZyme Description: GlcNac transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470		53223.55	9.0714

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01009870:1440-2856(-)

Full Sequence      

MKKSGFESTMGIVETNRSVNLDPSVQHIPLNPSQSHLRPPPPRVPNDPTLFVGLSVFRDG
YRCAKTIFTGLKRATNPNNVVFGLIKCTHLTKNVWMHFVSWLQKSGLISESTLIRITFES
MNVQRESRGPTLARHQQQKLIQDEEFCLQLDGHSIFTNGWDENLLKEWKGIGNEMAVMTT
YIHHIHNFVADNGDNVPPKKLELPHLCTTMRGANGLVRTVGASMIGGSKMPQLEALWGAG
FSYNKCHAEKRVPVDSHTLWIFDGEEFLRASRLWTHGYDMYSPSRLGTVVYHNYTSVPAR
FEGIPVEQKIKDKEEEMGINRFKLLVGQPFEGRVSTMELDKFGFGNVRSFKQYLEFSGVT
FDEGKKDAESCEQRHWVPYSNATDVEEIVGGGWKLYNTNTPKSSRQNVLEIAGHLQQRVP
DNVNTNTFTSLLSVLLVLGIAVFVVAFSNNSFSRRIRRHIRSKAQHNSSE

Enzyme Prediction     

No EC number prediction in PHPALM_18372-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT60	49	361	1.7e-50	0.9939393939393939

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371506	GlcNAc	7.59e-33	49	361	1	349	Glycosyltransferase (GlcNAc). GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1, a ubiquitous eukaryotic protein, in the cytoplasm.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVE55543.1|GT60	2.30e-253	1	470	20	489
UIZ25301.1|GT60	1.84e-236	1	470	1	471
UIZ22573.1|GT60	1.09e-170	6	457	28	488
UIZ25379.1|GT60	8.91e-132	8	460	30	512
AFJ68853.1|GT60	1.09e-35	160	387	1	225

PDB Hits     

PHPALM_18372-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T1C6|GNT1_DICDI	3.52e-14	46	292	2	247	[Skp1-protein]-hydroxyproline N-acetylglucosaminyltransferase OS=Dictyostelium discoideum OX=44689 GN=gnt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000002

TMHMM  Annotations     

Start	End
431	453