CAZyme Information: PHPALM_18128-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_18128-t46_1-p1
• CAZy Family: GH16
• CAZyme Description: Pectinesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338		36588.03	5.4050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01009760:1838-2854(-)

Full Sequence      

MQILAPLVTLAAFIVATEGTCTGPNARTQPPAGAIVIDPTGAYSGSFKTVSEGVAKLPNT
TTEHTLFLFPGTYEEQVTVPKIKGPLVVQGYTCDTTSYAANEVTITHAMAQKDVPASITK
DRNDYTTTLLLKSSNVKVYNLNVANTAGNVGQAIAMKVDGTNYGFYACNLTGYQDTLYAN
KGPELFAKSYISGAVDFVFGLYAKAWFEKCDIESIGKGCVTANGRTNDSNPSEYVFNNAR
VFGSKPGTAFLGRPWRPYARVVFQNSDLSDVVNPQGWQLWNGDNNTANVYFKEYNNTGSG
AATDKRVAFSGTLEKSVDITEILGEGYQSAWWVDKTFM

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	44	314	1.9e-75	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	4.84e-50	31	313	9	272	putative pectinesterase
395871	Pectinesterase	3.58e-49	44	311	9	276	Pectinesterase.
178113	PLN02497	8.48e-46	32	327	31	325	probable pectinesterase
215173	PLN02304	1.49e-45	35	313	77	354	probable pectinesterase
215357	PLN02665	7.68e-45	44	316	77	343	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54869.1|CE8	6.73e-221	1	338	1	338
AFM08806.1|CE8	2.72e-204	1	338	1	338
ACO54873.1|CE8	3.80e-171	6	338	7	344
ABQ63096.1|CE8	1.54e-170	6	338	7	344
ACO54875.1|CE8	4.53e-163	1	338	1	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	5.15e-62	25	337	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	7.26e-62	25	337	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	7.96e-38	44	311	16	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	3.29e-33	44	311	12	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	1.18e-13	61	301	64	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	6.13e-77	27	338	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	2.76e-75	27	337	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|Q4WBT5|PMEA_ASPFU	4.51e-69	27	337	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	4.51e-69	27	337	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	1.27e-68	27	337	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000351	0.999605	CS pos: 19-20. Pr: 0.9821

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_18128-t46_1-p1.