CAZyme Information: PHPALM_17612-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_17612-t46_1-p1
• CAZy Family: GH141
• CAZyme Description: Pectinesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	NCKW01009597|CGC1	38596.33	4.6582

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01009597:499-1554(-)

Full Sequence      

MYSFVLPLLALAGLTTAELSSTDPLCSGPNARTVPPPGAIVVDITGMYNGSYQTMAEGMA
YLPNTTEEHIVFVFPGVYQEQVLIPKLAGPLVLQGYTCDTTSYADNKVTITHTMAQRDLP
LEIKNSRNDLVSTMRLKSGSGVKMYNLNVANPTGKIEKLGQAVAVYVDNTNYGFYGCNFT
GYQDTLCAHKGRELYAHSYISGAVDFIFGMQAKAWFESCDFETVGKGWITANGNTNSSNL
SEYVFNNARVFNSNASMNGTTYLGRPWFPYARVVWQNSELGDVVNPEGWSTWKKGDNNTA
NIYFKEFNNTGPGAVVDQRVPFSGQLNSSISITEILGEGFEAEWWVDTTFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	49	328	3.9e-72	0.9201388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	4.76e-43	40	324	2	276	Pectinesterase.
178372	PLN02773	7.91e-42	50	326	15	282	pectinesterase
178051	PLN02432	6.65e-39	40	328	13	274	putative pectinesterase
215130	PLN02217	2.99e-38	40	324	252	526	probable pectinesterase/pectinesterase inhibitor
215357	PLN02665	3.81e-38	146	337	160	356	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54870.1|CE8	1.40e-207	1	351	1	347
ACO54874.1|CE8	9.77e-206	6	351	6	348
ACO54872.1|CE8|3.1.1.11	4.01e-198	1	351	1	348
ACO54875.1|CE8	2.29e-178	10	351	6	346
ABQ63096.1|CE8	3.09e-164	4	351	4	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	6.66e-60	31	350	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	9.39e-60	31	350	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.72e-30	49	324	16	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	3.20e-30	50	324	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	3.35e-74	31	350	19	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	2.99e-72	31	351	19	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|B0Y9F9|PMEA_ASPFC	4.75e-66	6	350	3	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	4.75e-66	6	350	3	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	1.88e-65	6	350	3	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999770	CS pos: 17-18. Pr: 0.9807

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_17612-t46_1-p1.