CAZyme Information: PHPALM_17606-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_17606-t46_1-p1
• CAZy Family: GH140|GH140
• CAZyme Description: Alpha-N-acetylglucosaminidase (NAGLU)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862		99307.60	6.1520

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01009596:547-3459(-)

Full Sequence      

MIPRRISVLFVAFLLPLAIEASTDLLKKDHDVVAATRGLIHRRLGAQYNDQISLRVLPSE
ADSLDVFELGSDGDKLEVAANSATAMAYGLQWYFKTVLHTQTDWDNHRLQLPYVLPKVEK
HVRHKRSAKFSYYQNVCTVSYSSWTWGWQQWEKHIDWMALNGINMPLAFTGQEKVWQNTF
QKHYNVSTAGLNKFFAGSAFLAWGRMGNLRGSWVKGPLPQAFIDDQHALQIKILERMREF
GMIPALPAFAGHVPEEMKGLFPNAKFTRSPNWGGFSEDFCCVYMLDSSNPLYHDIGKIFL
EEQRALYDYTSSLYQCDTYNEMDPDFTDLAKLQAASRAVIDSMTAADRNAVWLIQGWLFE
DSPDYWTKERVKAYLDGVTNDKMIILDLYSEVRPVWNKMDNYFGKSWMYCVLHNFGGNTG
MRGDLPTLGTAPVLANHDSNGTMVGVGLTMEGIYQNYVVYDLILQMAWVDTPLDMDEWVP
SYAAQRYHSQDAHTERAWGFLLQSVYNRTLGFGGVTKSLVCLIPHWKLVRDGFMPTLITY
DPMDVTRAWKELLSAGTQLHAVDTYRHDLVDVTRQFLSDSFMAQYLHLKDMYDDKKLPAD
QVCSWTERMLHTIERLDEILATNEDFLLGNWIADARALAETSELQDYYEYEARNQVTRWG
DNNSESIHDYAGKEWAGLVKGYYLPRWQMWLGEVCQSYTQGRKINEDVLKKARISFELKW
QLSHESYPTTTVGDSLTVSKRIFDEFAGTNVFQPLIIESHNMEQPVDKETAKAKFRSSRL
SWSNQAEHKLKQELSDIAISKCHSVAEKFAECAKANGLMVVFKCRDHNKALNACLHQYTN
DEQFEIYRQKREKEIPHEEKAN

Enzyme Prediction     

EC	3.2.1.50:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	73	743	4.3e-225	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	0.0	132	468	2	331	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	6.62e-103	478	740	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	1.50e-22	34	116	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.
400756	Cmc1	3.59e-11	801	853	12	70	Cytochrome c oxidase biogenesis protein Cmc1 like. Cmc1 is a metallo-chaperone like protein which is known to localize to the inner mitochondrial membrane in Saccharomyces cerevisiae. It is essential for full expression of cytochrome c oxidase and respiration. Cmc1 contains two Cx9C motifs and is able to bind copper(I). Cmc1 is thought to play a role in mitochondrial copper trafficking and transfer to cytochrome c oxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56008.1|GH89	0.0	18	754	13	747
AIG55486.1|GH89	2.55e-314	30	756	22	740
AIG56414.1|GH89	3.67e-255	4	749	2	751
AIG56322.1|GH89	4.35e-236	7	746	7	747
AIG55749.1|GH89	7.48e-232	4	746	2	748

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	6.63e-163	34	743	7	708	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	9.80e-91	37	751	175	882	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.13e-90	37	751	183	890	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.03e-89	37	751	198	905	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FNA3|NAGLU_ARATH	1.67e-171	34	746	47	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
sp|P54802|ANAG_HUMAN	6.85e-162	34	743	30	731	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999705	CS pos: 21-22. Pr: 0.9789

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_17606-t46_1-p1.