CAZyme Information: PHPALM_17289-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_17289-t46_1-p1
• CAZy Family: GH10
• CAZyme Description: Hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		40577.94	5.2457

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01009531:4890-5954(+)

Full Sequence      

MNTDSGASLLDDIPKKLQEEFGPLTLHSITDPRVAGFNSKVYAITHTEFEYVLFLDADNV
SVKDPSYLFESREFLQMGAIFWPDFWHPTHTIFNINEQSLLWELLDMPYTDMFEQESGQL
VIDKTRSSAALRMLSLFAFHDPNLFSRYKLVHGDKDLFRLAWLKTKTPFHMVANPPGIAG
TVRESKFCGMSMVQFDTDGEVLFLHRNAKKLTGGLGSNRKPDEQIWTHLQRFRYRASSPH
DREVEAAFEAAKPSFAPNETIDSPHVPVGNLNMPYSVLRQKYSIQIFNGAPEFDETQWCY
GQALITAPRYKTIAWEDTVFPNVERNLLQYANEAVVLLPESAVEYIVQHDREVA

Enzyme Prediction     

No EC number prediction in PHPALM_17289-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	27	196	1.7e-40	0.7424242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	3.15e-28	23	196	67	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	0.002	27	103	68	165	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28119.1|GT71	9.10e-79	24	337	58	357
UIZ24000.1|GT71	8.58e-65	15	237	294	511
UIZ27901.1|GT71	1.22e-64	29	232	234	435
CCA25306.1|GT71	3.83e-64	34	232	266	462
UIZ24059.1|GT71	1.71e-63	24	247	330	548

PDB Hits     

PHPALM_17289-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AP90|MNN23_CANAL	9.12e-14	33	194	248	447	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2
sp|P38069|MNN2_YEAST	3.92e-12	36	196	246	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q5AD72|MNN24_CANAL	2.39e-09	16	196	350	558	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|Q5A687|MNN22_CANAL	5.16e-09	33	194	237	434	Alpha-1,2-mannosyltransferase MNN22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN22 PE=2 SV=1
sp|P46982|MNN5_YEAST	2.85e-08	29	222	218	459	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_17289-t46_1-p1.