CAZyme Information: PHPALM_16993-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_16993-t46_1-p1
• CAZy Family: GH10
• CAZyme Description: Hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
912		103950.40	5.9628

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01009481:12203-14986(+)

Full Sequence      

MRGIVLFSWLLWGLCSVFSSSRSSCLHGDEVVDCDSVHSIRDPITSFRLIYPTDGAIETN
PIEFRTEVSVDSIEEYKNQYGDKLLCIELQGHLQRTKCSQLIRPRVVFDSLPSGNYTTRA
ILTSTDGNIQYYVTSDTTFTVVSKETLAVLMKRKIREEQNLIEWAGQRRVGSYGGEDVIG
SPVNHSTSTSSDILLVIGVKTAVVENFSFRQAIRETWASPDSVPHDVKVFFVGCVPTLTN
ELNAGKRQQIQEAIELEKQTYGDLLTDELRCEDSYDNLPTKVKEFLRFASQTFPHTPFVM
IADDDIYLRVDRLADELRKERRTQQLYIGQVWDTLLGRSQEPVRERTERYYISKSSYPLH
TYPPFAFGPHYILSMDCARFIASNSDRLRGLGAMDDVSVALWLLTKQVHVEHTLAFSNLR
IATCTNGLLSLADLSPFGIRSIHANLVTKRDFCFGFDEVGWQKIMKGLEFTEQSLPYPLE
IQTYVHNLEDTEYLYVTSIISTKDNAGVKVSYYPSAETFCAYSRRVCLEAHLVLGSSNFK
SWTCHGITQKLRAQVQQQFRIIEATGLISLAFLELWKYNLFVAEESAPPFIVAYTTESSY
ASVVFECIFKIIFEGHKRPVLVVPEKVLRVNYRNEPDVFIFSIFDSNCDPMSNPGCHEMI
EHYMDEYLLPTGNGKATKVMMISGEAIDTRQLDDRVPLLSSVSDVKRTWHVYLPIHTPVE
LLSLVPASLSSFKERRFCAYLYARCDRSLREYMFDLLNAMEPVDALGICAGSSRPPDNSY
RASRYFKWFNDEANYKFVIAFENSAEPGYVTEKLLNPFLAGSIPIYWGNSTTVSHLFNPD
SFIDCGRFEKLEDCAAFVLQVHKSPELYLQMRREPPIRNLTAFNEAFSWHPSVSTRSLAD
KVARMLHLDIVS

Enzyme Prediction     

EC	2.4.1.122:14	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	210	412	1.1e-43	0.9791666666666666
GT10	730	874	3.7e-35	0.39481268011527376

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	2.93e-27	210	412	3	194	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
395683	Glyco_transf_10	7.90e-18	747	870	15	132	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
215596	PLN03133	8.87e-16	195	403	387	579	beta-1,3-galactosyltransferase; Provisional
178735	PLN03193	2.30e-06	180	412	121	347	beta-1,3-galactosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCY68643.1|GT10	9.18e-19	730	881	114	266
UPW18992.1|GT10	4.75e-18	728	875	119	267
CAA2614104.1|GT31	2.91e-17	191	403	322	517
CAA7388343.1|GT31	3.43e-17	191	403	379	574
QHO50700.1|GT31	2.39e-16	189	418	387	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	1.13e-14	734	880	179	316	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	8.98e-14	734	880	179	316	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q864U8|B3GN5_PIG	1.23e-19	183	401	75	287	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Sus scrofa OX=9823 GN=B3GNT5 PE=2 SV=1
sp|Q9BYG0|B3GN5_HUMAN	1.24e-19	183	401	77	288	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
sp|Q8BGY6|B3GN5_MOUSE	3.93e-19	183	401	75	286	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Mus musculus OX=10090 GN=B3gnt5 PE=2 SV=1
sp|Q6P3P5|B3GN5_XENTR	3.97e-19	184	401	78	287	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Xenopus tropicalis OX=8364 GN=b3gnt5 PE=2 SV=1
sp|Q99NB2|B3GN5_RAT	7.15e-19	183	401	76	287	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000532	0.999450	CS pos: 23-24. Pr: 0.5461

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_16993-t46_1-p1.