CAZyme Information: PHPALM_16990-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_16990-t46_1-p1
• CAZy Family: GH1
• CAZyme Description: Hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
911		103427.02	6.0394

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01009481:12-2820(-)

Full Sequence      

MAGIDNNYFLGISHDPLTNFRITDPENGAVRSLPLDVRFAIDVTTVMEFDAYYADALLCL
ELNKQWKTCKVLRDPSIIFQSLPEGNYTASAYITDKNDQFRCHDTEEVAFTILSPDEYEL
HYARLVERSREEQHFPVDVDLLHWAEDVEIRDQGDGDTVLPRSRVSSTSSPMLLIGVKTA
VVTSFPRRQAIRDTWANPANLPHDVKVLFLGCEPNITSIQNEGDRRRIMEAVAKERAVYK
DLLTEELECTDSYRGLSDKVLSFMHLSAAEFPKAKFVMLTDDDIYVKVDQLAEGVRNGNR
SDGYFGEVWSLKFANKQKPIRDPESKYYLPEDQYPMRNLLPYASGPHYVVSMTGVRFIAK
NYWRLMSMNGLEDVSSGFWLKTTQVNAQHVSDFSSVRGSMKCLDTLTSFADLSPLGIRSI
HSNLVNNRSFCHGFHSVTWYRHFDMIPSLKKMLQRPTQETAHSNSLNFDLNSDENAVTPW
DIQIHVTNLTFSQYLEVASIVSTSSKASIKVKYFPSVETLFSYTQRVWVQVQTLVTGDKL
NSDSFGLELRTKLQQKFRSIEEAGSFNRATLELWRYNLFVADPEASPHIITHSRNAVYGS
TVLECLFVSIYEHHKRPILVMSEPFASEHYQNKPDVVVFSVLDADCEPVTKAACQHLIMS
YIDAYANQSDHSTTIMMIAGEPYDTEGLDERIILLSTVSGLSQKKYAYIPLASASFGERL
GHSPTTLLKPAFEPMVTKERRFCAYLYARCDRPQREYMFDILNAMEPVDALGICAGSSRP
PDHSYAASRYSTWYNDDAVTTFQNYKFVIAFENSGVPGYITEKLVNPFLAGSIPIYLGNS
TTVSEIFNPKSFIDCGHFQKLRDCASYVVKIHKSPELYAQMRRESPIGNLTAFNEAFSWH
PSISSRTLADK

Enzyme Prediction     

EC	2.4.1.122:14	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	187	389	2.2e-38	0.984375
GT10	732	884	9e-38	0.4092219020172911

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	2.05e-23	187	380	2	185	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
215596	PLN03133	1.48e-16	165	380	379	579	beta-1,3-galactosyltransferase; Provisional
395683	Glyco_transf_10	1.32e-14	767	878	30	130	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
178735	PLN03193	7.38e-06	160	392	128	350	beta-1,3-galactosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEJ34901.1|GT10	2.20e-20	676	884	14	210
QQR32886.1|GT10	6.18e-20	735	881	121	261
ANU61948.1|GT10	6.18e-20	735	881	121	261
ASB35439.1|GT10	6.18e-20	735	881	121	261
AGC02224.1|GT10|GT25	8.92e-20	676	885	383	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	2.65e-15	739	890	179	316	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	2.16e-14	739	890	179	316	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5UQ63|YR654_MIMIV	1.91e-19	676	884	369	565	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
sp|Q7JK24|B3GT1_GORGO	8.01e-16	171	394	78	286	Beta-1,3-galactosyltransferase 1 OS=Gorilla gorilla gorilla OX=9595 GN=B3GALT1 PE=3 SV=1
sp|O54904|B3GT1_MOUSE	8.01e-16	171	394	78	286	Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
sp|Q7JK25|B3GT1_PANPA	8.01e-16	171	394	78	286	Beta-1,3-galactosyltransferase 1 OS=Pan paniscus OX=9597 GN=B3GALT1 PE=3 SV=1
sp|Q7JK26|B3GT1_PANTR	8.01e-16	171	394	78	286	Beta-1,3-galactosyltransferase 1 OS=Pan troglodytes OX=9598 GN=B3GALT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_16990-t46_1-p1.