CAZyme Information: PHPALM_16466-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_16466-t46_1-p1
• CAZy Family: GH1
• CAZyme Description: Pectinesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		36802.98	4.5388

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01009005:373-1404(-)

Full Sequence      

MQIFAPLVAFTGLAAGVLADGVCSGPNARTEPPAGAIVVDVTGSYKNSFKTVQEGVARLD
PNTTSEQTVFVRPGVYNEQVLISPLSGPLVLQGFTCDATSYASNEVTITQAKAQKDIPKE
VTGEARNDMTSTVRFKTDNVKVYNLNIANTAGNVGQALAVNVNATDYGFYACNLTGYQDT
VLADKGRELYARTYINGATDFVFGRYAQAWFESCDIETIGTGFITASGRESASSPAIYVF
NRARVFGKSGVNSTVLGRPWRPDAKVVWQNSELGDVVKPEGWSTWDATSSTANVYFKEFN
NSGPGAATGSRVAFSGQLDAPVAIKDVLGEGYETEWWVDTTYL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	41	319	3e-71	0.9340277777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	6.38e-49	36	329	10	287	putative pectinesterase
178113	PLN02497	3.65e-40	34	339	31	327	probable pectinesterase
178372	PLN02773	6.83e-40	38	318	6	282	pectinesterase
215117	PLN02176	4.15e-38	27	329	31	320	putative pectinesterase
215357	PLN02665	7.15e-38	49	319	80	341	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54868.1|CE8	3.45e-221	1	343	1	343
ACO54869.1|CE8	1.95e-161	1	343	1	338
ABQ63096.1|CE8	6.76e-159	23	343	23	344
ACO54873.1|CE8	1.93e-158	23	343	23	344
ACO54872.1|CE8|3.1.1.11	4.92e-150	6	343	7	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	4.57e-58	29	342	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	6.44e-58	29	342	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	2.00e-28	30	316	4	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.90e-27	34	316	3	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	5.48e-13	47	306	46	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	1.15e-75	29	343	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	9.17e-75	29	342	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A1DBT4|PMEA_NEOFI	2.62e-66	29	342	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	2.62e-66	29	342	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	2.62e-66	29	342	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000219	0.999753	CS pos: 19-20. Pr: 0.9765

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_16466-t46_1-p1.