CAZyme Information: PHPALM_15032-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_15032-t46_1-p1
• CAZy Family: CE4
• CAZyme Description: ER degradation-enhancing alpha-mannosidase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777		85985.36	4.8305

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01008055:4076-7455(+)

Full Sequence      

MLYVYTYVSLLSIALLFIANSPVKAEIQADTPSPALSHFNGLHTLSGASYRAFKNRLKRQ
MRGENCLRYHVTGTWWHYEWCIDQHVRQFHPLPKGQKTKDQSIILGLYETEKPQPLRVLA
VDNLARLTDPDRMGYMAQQRYNAGDFLEEKSPCEYEMNVCSPVACGLMQRDQFVLTAPTF
MEEDERNALTRTVRDMFYHAYNGYLTHAFPQDDLLPLSCRGGEFELGRLPMLTLIDTLDT
LALLEDATEFRRAVGLVVENANFDLDTEVSVFETTIRLLGGLLSAHLFAVNTDLKLYPEG
DYNGALLRLAVNLGDRLMPAFNTVTGIPYGTVNLKYGVPKGETPIASTAGAGSLSIEFTM
LSVLTGEPRYAAASRGAMRKVVARTSRCSPPVPSPVALIKASKSATEKNAMTLPEKIAMA
ASDNAKPTTTVEEKVKKVDTESVASDVLQEWLPALEEKLRKIGGKSVEDKWLEELLDESS
LGSTNHHQPISEQGAQDHVVQYLYGGSQLGDFRVDQIPGRLRVTREETGDWIEASGVLDA
SHMIIGMGFSDGSDDDADADSYTFDESKHDKVEHIDDYHPPYLSWNHVYKVNEDLSLPVD
QRCSLRVQVGYTPYPGELQHNAKGKPHVGDDIKGKPNVWLTVPCVGAGFGVTDTFKASRA
FPNMELVVADPIDACSEVSNLSEDSIRGKIVLVQRGECYFEMKARNAAKWGAAGVIVVNT
ENDDLVMVMGGLEENSADATDEPLDVPVVMVPQRLGEWFETRLAESEASSLSPVKKI

Enzyme Prediction     

EC	3.2.1.113:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	196	388	8.5e-61	0.4170403587443946

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.89e-62	196	396	1	195	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.23e-36	183	378	66	251	glycoside hydrolase family 47 protein; Provisional
240122	PA_subtilisin_1	1.86e-18	645	772	1	117	PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1. A subgroup of PA domain-containing subtilisin-like proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following subtilisin-like proteases: i) melon cucumisin, ii) Arabidopsis thaliana Ara12, iii) Alnus glutinosa ag12, iv) members of the tomato P69 family, and v) tomato LeSBT2. However, these proteins belong to other subtilisin-like subgroups. Relatively little is known about proteins in this subgroup.
239038	PA_C_RZF_like	4.18e-18	666	757	44	131	PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like. This group includes various PA domain-containing proteins similar to C-RZF (chicken embryo RING zinc finger) protein. These proteins contain a C3H2C3 RING finger. C-RZF is expressed in embryo cells and is restricted mainly to brain and heart, it is localized to both the nucleus and endosomes. Additional C3H2C3 RING finger proteins belonging to this group, include Arabidopsis ReMembR-H2 protein and mouse sperizin. ReMembR-H2 is likely to be an integral membrane protein, and to traffic through the endosomal pathway. Sperizin is expressed in haploid germ cells and localized in the cytoplasm, it may participate in spermatogenesis. The significance of the PA domain to these proteins has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.
238300	PA	1.04e-17	643	767	1	120	PA: Protease-associated (PA) domain. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following: i) various signal peptide peptidases including, hSPPL2a and 2b which catalyze the intramembrane proteolysis of tumor necrosis factor alpha, ii) various proteins containing a C3H2C3 RING finger including, Arabidopsis ReMembR-H2 protein and various E3 ubiquitin ligases such as human GRAIL (gene related to anergy in lymphocytes), iii) EDEM3 (ER-degradation-enhancing mannosidase-like 3 protein), iv) various plant vacuolar sorting receptors such as Pisum sativum BP-80, v) glutamate carboxypeptidase II (GCPII), vi) yeast aminopeptidase Y, vii) Vibrio metschnikovii VapT, a sodium dodecyl sulfate (SDS) resistant extracellular alkaline serine protease, viii) lactocepin (a cell envelope-associated protease from Lactobacillus paracasei subsp. paracasei NCDO 151), ix) various subtilisin-like proteases such as melon Cucumisin, and x) human TfR (transferrin receptor) 1 and 2.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27914.1|GH47	6.82e-271	136	775	1	961
AIG56334.1|GH47	1.57e-92	23	386	1	380
AIG55397.1|GH47	1.78e-87	66	386	33	376
CAD7275460.1|GH47	4.99e-51	187	386	2	200
CAG1843572.1|GH47	6.45e-51	185	387	33	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	2.67e-25	187	373	3	176	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	2.76e-25	187	373	3	176	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1FMI_A	2.85e-25	187	373	8	181	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	2.91e-25	187	373	8	181	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	5.73e-25	187	373	86	259	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FG93|MNS4_ARATH	4.86e-50	181	386	32	234	Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	1.49e-47	165	381	13	241	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
sp|Q8BJT9|EDEM2_MOUSE	1.84e-46	193	381	39	225	ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Mus musculus OX=10090 GN=Edem2 PE=1 SV=1
sp|Q9BV94|EDEM2_HUMAN	1.61e-45	193	381	39	225	ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens OX=9606 GN=EDEM2 PE=1 SV=2
sp|O94726|MNL1_SCHPO	1.37e-39	189	386	35	242	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000408	0.999595	CS pos: 25-26. Pr: 0.9720

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_15032-t46_1-p1.