CAZyme Information: PHPALM_14998-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_14998-t46_1-p1
• CAZy Family: CBM43
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		39829.76	6.3037

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01008043:63-1233(-)

Full Sequence      

MSYSLFPPAPPHAPSGSAPPPPPAFRSTGDLQRLISPHFLSPEALLRPIPTNEWWGNLLA
WDGQRDSDAIFAGPYTYKLVQGQSGTIGSGLSVSYLPQYRTDGPINDNGAPRFYFYPPTI
KNWVFSAVELQGQSGPPPLTIQAWDDMGVHLAMAGMRTYLALGSAFTTVEYQDMQVQLGT
EHSIVAINGAPAREGHQVNEISFVISLNNGQQWVLYFFSSAGGNTSLVFEGNRLTTTSKF
TGVVQASFVSTSAVQMAVPQDDHKILQLYHASAGVYPRGASVQTLNSESFVFNWQLATAA
GSNPGARFLHFALTHLQGMLDPSTVEAKHELVLQSHTHGPLFAYMLSTPPNSNPTWLCHV
PQAESQG

Enzyme Prediction     

No EC number prediction in PHPALM_14998-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	38	345	4.1e-40	0.40836012861736337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397619	Glyco_hydro_81	8.13e-36	48	357	14	317	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
227785	Acf2	1.10e-20	48	362	89	394	Endoglucanase Acf2 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26643.1|GH81	2.83e-205	17	367	17	367
CCA20578.1|GH81	1.41e-52	49	345	206	495
CCA20582.1|GH81	1.41e-52	49	345	206	495
CCA20580.1|GH81	1.42e-52	49	345	192	481
CCA20581.1|GH81	1.42e-52	49	345	192	481

PDB Hits     

PHPALM_14998-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	8.60e-14	46	348	32	323	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	9.65e-13	48	339	225	508	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	8.27e-08	48	348	110	394	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	3.75e-07	47	345	459	753	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_14998-t46_1-p1.