CAZyme Information: PHPALM_14933-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_14933-t46_1-p1
• CAZy Family: AA7
• CAZyme Description: Sterol 3-beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1085		120143.10	7.5286

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01008019:34-3845(+)

Full Sequence      

MGHNVEFYPLGGDPKELAAYMVKTGGHLIPLSLEAIQKDVPRNMQMIEEIIQSTWPAVSE
ADPDGGGPGIPGKPFRAQAIIANPVSYGHIHVAERLGVPLHIMFPQPWVPTTAFPHPLSN
MPYTNKPKKVNYMTYKLVDLLMWQGTEGMVNTFRTEVLELRKIRKGDGGRDILLDLAIPH
AFMWSPHLVPKLKDWGQIYDVIGTVTLDGSGSSYSPTPEFETFLGKEDCGPIFVGFGSMV
LQDPNGVTNMIIKAAEQAHVRVLIQSSWSDMAGGIKVPDNIFFVGSCPHDWLMPRVSAVV
HHGGAGLQRRVSSLAKPSSSCRSSETSHSGVEPSWTLVLSSPELRKRAIELRDLMRQEDG
AGEAVRCFYSNLPVHLMRCDLDCGRAAMLWSQKDKLRLCNKCEFVVTSRPENSPRDIVEY
TYVDYSGRGPDNMLEGASSGVGAMAHAIGSGIKDVFVKPTEGYREEGAKGAVVGLVKGLG
GLMISPLVGTMIFADHLATGAYNNGREKNEKKRGSLIKGNNKFLDIMGFKSRNVHTSSMN
TDEVVDGSTTTVTKFLEYVHHQVQHKTQSKPYLLNVNLGLDPFSDMDDLRELVFSLWPAL
FGHTVVAERLGIPLHCMSDIPQSKTEAFGNLLNSSNGLSRPYSSAPANVASYDVVDKLAY
DIMGYILDEFRYSLGLTGKTPVANLLTVWRIPHTYLWNPVLLPKPHDWRSEITVAGYTEL
KDNNGFGDCDIVSVEHELRSFTENHVGTPIIYFGFQCDDWDSRRVQELMSIVVKAALTAG
VCIIFQGNKIDTGRKSGNDIVFKIDRQFPVKRILSYVHSTVHWGDLSITSTCLAAAKPAC
VIYRNTTQRLWGQALASSGAGVRPLDMAALTPSHLFDTFHALIDPKLADCAKRFAPSFSS
SDAIKDAVSAFYTNLPLHDMTCDLDPTRIARVYDSVHELKLSYEARLAVHQITGDGGSAY
DLKYKPLKYSQRHPPKVSLRQLDTKQLRSSSSSFDYKNHPRVVYMHDPASEYLEKGRSPR
KRRESLLRGQSMALNVIEMPKYWSSPEEQAKSVEEINSKYEHLLCLRESHRGSSLTSSGS
SSTSG

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	73	366	9.5e-27	0.7408376963350786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.20e-37	2	306	46	318	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.44e-11	85	366	104	393	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
224732	YjiC	2.84e-07	745	907	234	391	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
401321	ATG_C	2.09e-06	430	490	8	68	Autophagy-related protein C terminal domain. ATG2 (also known as Apg2) is a peripheral membrane protein. It functions in both cytoplasm-to-vacuole targeting and in autophagy.
340817	GT1_Gtf-like	2.29e-06	586	886	89	376	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23942.1|GT1	0.0	1	1067	119	1442
CCA24416.1|GT1	2.21e-235	5	1070	114	1396
CEF74027.1|GT1	3.65e-82	5	513	140	676
CZS77295.1|GT1	6.88e-82	5	513	140	676
QPC76318.1|GT1	2.28e-80	5	513	141	677

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	6.88e-35	3	306	65	353	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	9.27e-35	3	306	85	373	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	1.38e-07	219	317	212	306	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	2.50e-07	92	306	112	312	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	5.10e-72	5	373	240	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	7.30e-71	5	376	203	578	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|P0CN90|ATG26_CRYNJ	2.08e-37	2	317	1078	1393	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1
sp|P0CN91|ATG26_CRYNB	2.08e-37	2	317	1078	1393	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1
sp|Q6C8M8|ATG26_YARLI	2.56e-37	2	317	1039	1343	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_14933-t46_1-p1.