CAZyme Information: PHPALM_14588-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_14588-t46_1-p1
• CAZy Family: AA6
• CAZyme Description: Beta glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775		84621.35	4.3585

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01007928:3973-6300(+)

Full Sequence      

MLKKWLLAVCCAALGLVVTTTADDFDARANSIVDNFTPEQVIGQLAQVAIFSVLNEDYSL
NEDLVRYYAKLHVGSFLTTPFTNGANELTGAVGWNVDEWRDIITRIQDIVMEENDGIPMI
YGIDSVHGAGFILNTTLFGAQINGAASFNPDLVYEMGRVTGQDTQAAGIPWVFGPILEVS
QNPLWPRTYETFGEDPHLVSVMADAVIRGLQSNNQTAACMKHFVAYSKTPTGHDKDGVQI
SDFDLLNYFVPPFKAAIDAGVLTTMENYVSLNGVPTIGNHKILQQLLREDLAFDGLAVTD
FGEMGSLNSFHRIARTVDEAVRMSYTHTGIDMSMGVGDVYLNSTKLLFEESPEYFDRLKQ
SAKRIIKTKLKLGLFDTPIPGIDDVAKVRNEVDIEKSLEMARESIVLLQNNDSTLPISSS
SSVFLTGHSAHNIGNQCGGWSVSWPGYTGNEHFPNGISVKEGMEAIGGDKVAYFNGLDSD
GTYSSANLTTAKEYASKAEYTVAVIGEHPYAEKTGDIDDLALPVGQIEYVKELASTGTKV
IVVLFEGRPRLLDDLPENVHAVIHGLLACEQGGKAMAEILYGQVNPSGRMPITYPKDSGN
VMIPYNHRVSTQCADSDYCEMQWDFGTGLSYTEFTYSDLTLSKTNVTSSSDTIDVSVVVT
NSGSVAGKETVMLFLIQPYRSISVPEVKQLKQFSKISLEPGQTQTVTFSLTANDWSVYYP
QIGSGMKLVAEDTDYVVAIKPETDCDVYNETAAANPLCATFTLQTGDYPYGVFLG

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	113	334	2.5e-61	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.88e-111	100	739	86	750	beta-glucosidase BglX.
224389	BglX	1.50e-69	37	442	2	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	5.38e-51	37	366	1	314	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	5.14e-45	124	710	89	742	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	2.27e-38	405	631	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	8.08e-311	1	764	1	763
UIZ27116.1|GH3	1.62e-290	45	764	1	725
UIZ29613.1|GH3	4.38e-288	1	769	46	825
UIZ29432.1|GH3	1.17e-286	1	769	1	769
CCA27737.1|GH3	1.70e-281	16	764	55	809

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	1.25e-119	18	714	6	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
7EAP_A	1.30e-82	26	717	15	726	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5YOT_A	1.30e-82	26	717	15	726	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
6R5I_A	2.54e-82	100	722	55	705	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.31e-81	100	722	55	705	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	1.86e-135	24	739	71	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	9.14e-119	18	714	28	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	5.39e-87	71	746	9	713	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	4.76e-81	100	710	86	725	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	6.49e-80	100	710	86	725	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000293	0.999692	CS pos: 22-23. Pr: 0.9710

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_14588-t46_1-p1.