CAZyme Information: PHPALM_14504-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_14504-t46_1-p1
• CAZy Family: AA3
• CAZyme Description: Pectin methylesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		38232.70	4.7476

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01007910:1865-2911(-)

Full Sequence      

MYSFVLPLFALAGLTTAELSSTDPLCSGPNARTVPPPGAIVVDITGMYNGSYQTMAEGMA
YLPNTTEEHTVFVFPGVYQEQVLIPKLAGPLVLQGYTCDTTSYADNKVTITHTMAQRDLP
LEIKNSRNDLISTMRLKSRSGVKMYNVNVANPAGPIEDLGQAVAVYVDATNYGFYGCNFT
GYQDTLCAHRGRQLYARSYISGAVDFIFGMRAKAWFESCDVKSIGEGYITANGNQNSTIE
SEYIFNRARVSGSSGNGSTYLGRPWRPYARVVWQNSELGDVVNSQGWSTWNGDNKTENVY
FKEFNNSGPGAVTDQRVSFSGQLNASVAITQLFGEGFESEWWVDTNFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	49	326	2e-73	0.9236111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	2.16e-48	40	321	2	276	Pectinesterase.
178372	PLN02773	2.57e-45	50	323	15	282	pectinesterase
178051	PLN02432	2.51e-43	40	328	13	277	putative pectinesterase
178113	PLN02497	1.38e-41	40	344	34	327	probable pectinesterase
215367	PLN02682	2.84e-41	36	343	67	367	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54872.1|CE8|3.1.1.11	5.17e-214	1	348	1	348
ACO54874.1|CE8	3.53e-205	6	348	6	348
ACO54870.1|CE8	8.07e-197	1	348	1	347
ACO54875.1|CE8	1.29e-167	10	348	6	346
ABQ63096.1|CE8	7.15e-167	1	348	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	6.26e-63	31	347	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	8.84e-63	31	347	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	1.04e-35	50	321	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.58e-33	49	321	16	283	Pectin methylesterase from Carrot [Daucus carota]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	1.51e-77	31	347	19	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	2.71e-75	31	348	19	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	9.60e-65	6	347	3	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	9.60e-65	6	347	3	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	2.70e-64	6	347	3	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000197	0.999778	CS pos: 17-18. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_14504-t46_1-p1.