CAZyme Information: PHPALM_13634-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_13634-t46_1-p1
• CAZy Family: AA17
• CAZyme Description: Hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		48814.58	6.1966

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01007581:35-1304(+)

Full Sequence      

MLLVLLLYTSFLLVWFVYMDRRSNEGNREFLGNFISAANMDETKWNYLHAHEDLELRTEI
PFAELEMEFLHQNNNSSDREDQTITDAEAHAKTLKPYPVSETKIRRLRCIGWRATDNCSP
DGPRIPRFDEPCNKVITFGASGYCEVQDKDTGENFKVMQRHCSSVRDTARFRCSESWDFA
VFPQKAREAVEKAHDHNFMLPNISPKLDHLQEPRDGIVMVVYPKLLASAYATIRALRELL
NCHLPIELWFRSQEMKFFPEAFTQLQEWSSETKGSITFREIGEPGVVGFATKVFAIYHSF
FERVLFLDADNVPVRDPTFLFASPEFQETGAVFWPDFWHPSKTIFNIQPHSLIWELLDLP
YVSMFEQESGQLLVDRRRHAVPLELVKFYIFHRPNHFDKMKLAHGDKDLFRWGLRST

Enzyme Prediction     

No EC number prediction in PHPALM_13634-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	215	415	1.8e-40	0.8560606060606061

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.05e-28	215	410	2	229	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	1.05e-04	301	346	90	143	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28119.1|GT71	6.14e-82	219	411	1	193
UIZ24000.1|GT71	3.00e-80	107	412	104	438
CCA25989.1|GT71	4.40e-79	109	417	98	413
UIZ24059.1|GT71	1.86e-74	90	417	696	1048
UIZ27901.1|GT71	1.74e-73	107	417	70	371

PDB Hits     

PHPALM_13634-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59KJ7|MNN21_CANAL	4.21e-14	188	410	219	486	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|Q5AD72|MNN24_CANAL	9.85e-12	286	410	364	518	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|A6ZQE9|MNN5_YEAS7	1.54e-11	205	410	140	394	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P46982|MNN5_YEAST	1.54e-11	205	410	140	394	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|Q5AP90|MNN23_CANAL	1.11e-09	200	410	160	410	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999816	0.000224

TMHMM  Annotations     

Start	End
2	19