CAZyme Information: PHPALM_12621-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_12621-t46_1-p1
• CAZy Family: AA17
• CAZyme Description: Heme peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		37907.15	9.4485

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01006728:1518-2543(-)

Full Sequence      

MLRRAALRAAQQASAASAAKTRSFATSQLRTASKKKQPSAIVLAAAGIAAVSGLALTDLV
NAREKPVDLDAIKKEIIEIFDEDNYMGPTLVRLAWHSSGTYKAKDQSGGSTGGTIRFDPE
INHGGNAGLHLAVKALEKVKKNHPEITYADLYVLAGVTMIEEMGGPEIPFRLGRPDAKSG
KEPTQTPDDRLPNADMGSKDKTTQHVRDVFYRMGFDDRDIVALVGAHAIGRCYPTRSGYS
GPWTNAEWTFSNEFFRELIENKWTIKKWNGPTQYEDPTGKLMMLPADMVLIQDPKFKKYV
EMYAQDEDLWFKDFSKAFVKLTENGVKFQETSGWRKFFGGK

Enzyme Prediction     

No EC number prediction in PHPALM_12621-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	72	325	9.1e-59	0.9607843137254902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	8.69e-147	60	328	4	252	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	2.17e-77	88	327	32	245	L-ascorbate peroxidase
178467	PLN02879	1.40e-63	83	330	30	251	L-ascorbate peroxidase
166005	PLN02364	1.40e-63	87	325	33	246	L-ascorbate peroxidase 1
173823	plant_peroxidase_like	6.19e-62	70	323	1	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22874.1|AA2	6.73e-209	1	341	1	342
QKY15243.1|AA2	7.86e-94	65	332	92	368
UKZ92149.1|AA2	8.45e-92	61	332	79	342
BDA47129.1|AA2	2.05e-90	70	330	97	350
QRD85779.1|AA2	6.99e-90	70	329	96	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AL9_A	6.34e-77	62	327	1	260	Structure of Leishmania major peroxidase D211R mutant (high res) [Leishmania major],5ALA_A Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major],5ALA_B Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major]
3RIV_A	6.55e-77	61	327	1	261	The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin],3RIV_B The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin]
4GED_A	8.42e-77	62	327	1	260	Crystal Structure of the Leishmania Major Peroxidase-Cytochrome C Complex [Leishmania major]
5AMM_A	8.98e-77	62	327	1	260	Structure of Leishmania major peroxidase D211N mutant [Leishmania major],5AMM_B Structure of Leishmania major peroxidase D211N mutant [Leishmania major]
3RIW_A	2.10e-75	61	327	1	261	The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin],3RIW_B The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WPF8|CCPR_ASPFU	1.09e-92	70	338	100	362	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|Q7SDV9|CCPR_NEUCR	1.76e-89	68	332	86	348	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|Q4PBY6|CCPR_USTMA	4.75e-88	80	341	130	384	Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP1 PE=3 SV=1
sp|P0C0V3|CCPR_EMENI	1.41e-86	80	328	107	347	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1
sp|Q4ING3|CCPR_GIBZE	1.81e-86	71	330	92	343	Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999971	0.000070

TMHMM  Annotations     

Start	End
40	62