CAZyme Information: PHPALM_12452-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_12452-t46_1-p1
• CAZy Family: AA17
• CAZyme Description: Multicopper oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481		52650.01	4.3498

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01006653:1679-3124(-)

Full Sequence      

MDGMSGFTQCAIEPNSSATYRYTPDKVGTFWWHSHHGTQYSFGLRGPLIVHGRESEQMSW
DEEYIVQLADIYHAPPPPGPVLWDTIVVNNLGRYNCTAAATLNLTDCDPDQPLSRFNFQP
GKKYLLRLINMAAMATFEFSIDGHEFQVIAADAEPVVPTENINAIIINVGQRYDIIVQAK
EDTQGMGSFWMRAKGLTGYPWTARTADTGAPGFNDEGLAIIQYGSLTTSGPATEKDGKTA
TIGEFDFIPAMLDVLPTTPDDRFTMRFNINTTIGTGIVSLDGGDFQTLVVPDEPPLLSIA
SGLSTTELPISANARAIEFGDHVEVVLMNDVIEQHPFHLHSHVAWVVGSGHASAEDVYNN
NLPELKLDGPMLRDVYTVPACDVDEAGACVNVGYVVLRFKADNPGVWMMHCHVDWHMAIG
MGMIFVEGEAELQKKGPNAFSSSLLSVCKREESNYGSEDQGKSEHINEGVDDNEDAHCSV
G

Enzyme Prediction     

No EC number prediction in PHPALM_12452-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	1	421	8.5e-75	0.8324022346368715

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	7.43e-53	2	428	71	524	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
177843	PLN02191	2.12e-49	2	428	93	547	L-ascorbate oxidase
225043	SufI	1.58e-48	1	430	99	451	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].
215324	PLN02604	1.85e-43	2	428	94	547	oxidoreductase
274556	laccase	2.01e-40	2	434	72	528	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFY09916.1|AA1	3.74e-183	1	448	94	544
AFY09915.1|AA1	2.43e-171	1	448	92	565
UIZ26488.1|AA1	1.76e-169	1	448	85	536
UIZ26495.1|AA1	2.11e-169	1	448	94	561
AIG55536.1|AA1	2.46e-79	2	448	110	553

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HFU_A	2.31e-57	2	430	77	471	Chain A, LACCASE 1 [Coprinopsis cinerea]
1A65_A	2.36e-57	2	430	77	471	Chain A, Laccase [Coprinopsis cinerea]
5Z1X_A	4.12e-53	2	437	77	475	Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z1X_B Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z22_A Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena]
1V10_A	1.83e-52	1	454	97	514	Chain A, Laccase [Rigidoporus microporus]
1KYA_A	4.51e-50	2	437	77	479	Chain A, Laccase [Trametes versicolor],1KYA_B Chain B, Laccase [Trametes versicolor],1KYA_C Chain C, Laccase [Trametes versicolor],1KYA_D Chain D, Laccase [Trametes versicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A067XMP2|PTAK_PESFW	4.16e-55	2	432	133	553	Oxydoreductase ptaK OS=Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) OX=1229662 GN=ptaK PE=2 SV=2
sp|S8FGV1|LAC2_FOMPI	1.55e-52	2	432	101	506	Laccase-2 OS=Fomitopsis pinicola (strain FP-58527) OX=743788 GN=LCC2 PE=1 SV=1
sp|Q12729|LAC1_PLEOS	1.09e-51	2	427	109	498	Laccase-1 OS=Pleurotus ostreatus OX=5322 GN=POX1 PE=2 SV=1
sp|Q12739|LAC2_PLEOS	1.64e-51	2	427	111	500	Laccase-2 OS=Pleurotus ostreatus OX=5322 GN=POX2 PE=1 SV=1
sp|J5JH35|OPS5_BEAB2	2.24e-51	2	432	143	556	Oxidoreductase OpS5 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=OpS5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_12452-t46_1-p1.