CAZyme Information: PHPALM_12266-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_12266-t46_1-p1
• CAZy Family: AA17
• CAZyme Description: Hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594		68846.92	6.6748

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01006579:160-3020(-)

Full Sequence      

MRKVTASIDPLHQLAANDSIDITFREIDDPAAVAFSTKVFAIYHSAFDRVLFLDSDNVPV
RDPSFLFQTPEFASTGAVFWPDFWHPQHTLFYLGEDSLLWELLDLQFVDMFEQESGQLVI
DRRRHGAPLELLHFFTFHRPNPFVQLKLVWGDKDLFRLAWLKLEVPFTMIQSPPAIAGKN
INGSFCGMTMVQHDAQGAVLFLHRNSHKLTGGTTRNPADKKLKAIQEKLPSETMIRKYED
GYPDAAIWTHLLSFRRSSPRSKYQIETYHAGPEFSKNQICYGQRYPDTNENFYVQEFASM
SFSELETHLRRFAMEAGRLHQVKVDAEVFALYNSDFERILFLDADNVPVRDPAYLFETPE
FEKTGAVFWPDYWHPHYTIFHLHGDSLLWELLDMPYIDMFEQESGQLLIDRRKHTAPLEL
VRFFTFHVPNPIEKLKLLWGDKDLFRLAWIKLNVPFYMIQTPPAVAGLVNGTSFCGMTMV
QHDAQGEVLFLHRNAKKLTGEVLYKPVNYHIEARKRIRSRLVKQGIHKIPTEEEVVKELK
IMKKTPPPTLEPAEPDGIADQAIWTHMLSFRKNAPLPEYKVKSYSAAPEFPEKQ

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	33	194	1.2e-38	0.7121212121212122
GT71	261	483	4.9e-38	0.8939393939393939

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	3.16e-26	330	483	88	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
402574	Mannosyl_trans3	7.38e-26	35	194	81	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	1.04e-05	47	82	90	126	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133018	GT8_Glycogenin	2.08e-04	328	372	84	127	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28119.1|GT71	2.87e-115	7	323	44	361
UIZ24059.1|GT71	2.51e-98	10	512	319	1109
UIZ24000.1|GT71	3.09e-69	25	316	305	567
UIZ28362.1|GT71	2.41e-60	21	211	833	1026
UIZ27901.1|GT71	4.72e-60	326	512	244	433

PDB Hits     

PHPALM_12266-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38069|MNN2_YEAST	6.03e-15	330	483	253	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|A6ZQE9|MNN5_YEAS7	2.58e-11	327	483	229	433	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P46982|MNN5_YEAST	2.58e-11	327	502	229	452	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|Q5AD72|MNN24_CANAL	2.07e-10	35	170	367	532	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|Q59KJ7|MNN21_CANAL	6.00e-10	38	196	332	528	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_12266-t46_1-p1.