CAZyme Information: PHPALM_11603-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_11603-t46_1-p1
• CAZy Family: AA17
• CAZyme Description: Glycoside hydrolase family 17-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		31142.04	4.6952

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01006411:1113-1994(+)

Full Sequence      

MKFFAPISAAIAVFAAQVNANGVCYDPDHASVSGAMTAESVKADMATIKSQGFTTVRTYI
SKFGGTNLGQVISSCNVTSALGVPYPQSDYVEQMEAAVTAANSGGVAYIFVGNENLAGAA
EVPYDMIAVINKIKSLVPSTVKVGTVQRNTEVINYAGINNWPALYAVIDVLGVNAHPYFN
PGTTADKAIDVLKNQWTVMEANFGDKLMLTETGWPSDGTLSGNTGSIAGMQTFYSDYKSW
SSSKSESFYFQLFDTPYKTTAYEKTFGLLTSDSVAKFDLAAASQTAGTVKPGW

Enzyme Prediction     

No EC number prediction in PHPALM_11603-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	42	279	1.2e-16	0.9421221864951769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.16e-19	22	272	47	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24978.1|GH17	1.31e-103	1	276	1	274
UPT50359.1|GH17	2.89e-28	4	279	10	287
UIZ21797.1|GH17	3.76e-27	16	276	568	829
AIG55417.1|GH17	1.44e-21	22	283	29	284
AIG55961.1|GH17	1.18e-20	1	285	2	278

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	6.46e-07	109	276	128	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8MXP5|BTGE_ASPFN	4.23e-13	22	222	348	549	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1
sp|Q2US39|BTGE_ASPOR	4.23e-13	22	222	348	549	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
sp|Q0CEX9|BTGE_ASPTN	1.78e-12	22	222	304	506	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1
sp|A1DBG6|BTGE_NEOFI	8.52e-10	40	222	314	499	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|A1C499|BTGE_ASPCL	1.55e-09	22	222	310	512	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000202	0.999788	CS pos: 20-21. Pr: 0.9764

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_11603-t46_1-p1.