CAZyme Information: PHPALM_1119-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_1119-t46_1-p1
• CAZy Family: AA17
• CAZyme Description: Glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240		26482.65	6.3247

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01000211:4177-4899(-)

Full Sequence      

MRQVSEHFSSIRTYQAQFNGVNAISMAAAAGLHIAVGVQLTDPRWIDSEIQAVCDGYAKN
SWAVEAVYVGNEDLKNGNFGTYTADQLAGFIRRVKNCVGNTPVGSAQRINEWLGADGAWT
LANACDVIGVNIHPFFTPGSQSALKKLEAQWDQMVSKFGAAKVRLTETGWPYAGQSYAGN
VPSVGAMTQYFYDYVYGWCPNKSQSYWFMMYDTTVSYNGADYEKHFGLFGTDKSPHINMP

Enzyme Prediction     

No EC number prediction in PHPALM_1119-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	7	237	5.5e-18	0.9035369774919614

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.25e-21	3	233	71	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPT50359.1|GH17	5.81e-143	1	240	49	288
UIZ21797.1|GH17	3.76e-88	1	240	594	834
UIZ21931.1|GH17	4.67e-78	4	240	52	288
UIZ21795.1|GH17	2.12e-53	4	153	52	202
CCA18992.1|GH17	1.53e-38	3	240	44	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.30e-11	11	234	69	287	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	8.23e-11	11	234	69	287	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y9Q9|BTGE_ASPFC	6.49e-14	5	182	337	516	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	6.49e-14	5	182	337	516	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|A1DBG6|BTGE_NEOFI	1.18e-13	5	189	324	508	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|A1C499|BTGE_ASPCL	5.29e-10	5	183	337	517	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|Q04951|SCW10_YEAST	6.98e-08	8	183	166	342	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000016

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_1119-t46_1-p1.