CAZyme Information: PHPALM_10760-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_10760-t46_1-p1
• CAZy Family: AA17
• CAZyme Description: Trehalose-phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740		82865.18	6.5420

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01005707:115-2334(+)

Full Sequence      

MLTDVIAEEIEQVASPTSSFTRGPTRRRAESGPGEDVASPVAKLQAVSEDMPTTNPAPTS
PRATAGNVTMEATDGVIIAVHRLPVLVHRTPEGHYHIEWEDDNLICPSGLLKDSYREANW
DRVSSMRLTWVGTVHCAEPIPKEDEERLAKQLEDFHCVPVFLAEPLSSTFHNFCYGTLWP
VFHNIVDVYGALPTRWWNPGQQRNAWASYKTVNRIFVNKVIEVYNEGDLVWVHGLHLLVA
PSFLSRRLPCVNVGIFLHTPFPSSEIFRTLSMRADLLRGVLAADHIGFHLYEHARHFLTS
CRRILGLKYSAQPGGYIGVEYSGRMVMLTISHIGIEPTFMDRINSSDQVEQDAAVLAAKY
ESSTRKVFVSVDRVERLKGILLKLGAIEFFLAQHPEYVDKVQFVQIGIWDSSNPTPEKDS
VRAEILAHMKRINDRFGEHHKEPIFAYSEVENTDMASRLPLWRVGHVLLTTSVRDAVNLY
PFEFIYAHELAKSPGVVIVSEFSGSSRVLTGSIGVNPWKREEIIQAMELALKMSEEERAA
RHQKDLEYIITNSRTKWAERILVDLKRTKKQTAEGEYMGYGLGLGFRMLEFNAGFKMLET
DVLAKAYRETFRRVIFFDYGNTLTLEESAGAHSFTKYITGNEQNAFVSKTETPKASSDLL
ASLTLLCADPRNTVFVLSGKERLDLEKTLGSVRGLGLAAEHGYLYKWGTGTNANAGNTPV
SRAPPSSGSSSNSLASEVEE

Enzyme Prediction     

No EC number prediction in PHPALM_10760-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	67	567	2.9e-130	0.9873684210526316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	7.49e-144	76	566	2	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
177855	PLN02205	5.90e-136	41	706	27	668	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
395781	Glyco_transf_20	1.43e-135	76	567	3	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	1.22e-109	75	706	2	565	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215555	PLN03063	2.35e-108	76	710	13	587	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24099.1|GT20	0.0	1	740	222	951
CCA19238.1|GT20	0.0	67	708	256	900
AGT20052.1|CBM20|GT20	7.75e-144	74	707	173	786
UIZ27356.1|GT20	7.65e-143	76	716	24	653
BBN16912.1|GT20	7.94e-124	60	707	43	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	3.77e-84	76	573	14	482	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	1.96e-83	76	567	2	464	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	3.02e-82	76	565	13	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	1.75e-78	76	571	6	473	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	9.25e-78	76	571	6	473	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O23617|TPS5_ARATH	5.75e-113	74	712	60	669	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2
sp|Q94AH8|TPS6_ARATH	8.85e-110	74	706	53	674	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana OX=3702 GN=TPS6 PE=1 SV=2
sp|Q9LRA7|TPS9_ARATH	1.44e-109	77	707	62	664	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|Q0WUI9|TPS8_ARATH	8.45e-109	77	707	60	659	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q9ZV48|TPS11_ARATH	2.12e-105	77	707	53	656	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 OS=Arabidopsis thaliana OX=3702 GN=TPS11 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000006

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_10760-t46_1-p1.