CAZyme Information: PHPALM_10454-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_10454-t46_1-p1
• CAZy Family: AA1
• CAZyme Description: Glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679		70022.49	4.4237

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01005485:4-2869(+)

Full Sequence      

VVYGLPPNDCDAGYSNGNGTVKTGADYKEFITNLTSLVGERKVLYVLEPDAVGLLANKGC
AVEYGYQSNLTTAISLLSANPNAEIYLDVGFWTLERSDTADIVAQIVNELAQTGRVKGIA
LNTSNYRSTTQIAELCTNFQKAIGSTDMTCVIDTSRNFQEYANASSSAWCNVRKAGIGAP
PTNVTDFDNIDYWVYVKPPGDSDGTCVDQSSDSMHGPQAGEFFNDHFIKLWNQGYFVNAQ
QMSTIYDPNAETSGSAAPMMPPWFTSIAALLVTLSLHAHQCRCQRLAGVYGRLSLASRLL
PAAPADSKKTPTAKMFRKFAVCTAVLVAVLTNDALALQQGGSFTPTTGGNQDDSYTTTTK
GPVVTQPPSVPATTAPAVTPATTTPAPEVTPATPVSTPAATTPAPETPITEAPIATPAST
PTTPSIPTTGTKAPSVTPAATTPTSEEGSHQTDVPPSIPTTGTKAPSETPAATTPTSEEG
SHQTDVPPSVPTTGTKPPSVTPTATTPTAEQGSHQTDCNPNFPTEETEAPVATPTATTAT
PAVTPAATTATPDVTPAATTPTSPKQGVVTPAPTTSTDVESSASKTNSASTTEDSGSDTI
DQTAQQATTKSGEDSNKGGNSTVLTFCIIGAVAAVAAVGVAASRMKNAREADAALATPGD
NENIHIEIKRTPAGGSTIL

Enzyme Prediction     

No EC number prediction in PHPALM_10454-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	1	207	9.4e-50	0.7619047619047619

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	4.68e-37	1	206	50	287	Glycosyl hydrolases family 6.
227616	CelA1	1.15e-13	3	286	191	482	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].
411345	gliding_GltJ	6.28e-10	248	500	307	565	adventurous gliding motility protein GltJ. Adventurous gliding motility protein GltJ, also known as AgmX, occurs in delta-proteobacteria such as Myxococcus xanthus.
223021	PHA03247	3.57e-09	358	588	2762	3006	large tegument protein UL36; Provisional
223021	PHA03247	1.62e-08	344	596	2721	3003	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23635.1|GH6	7.56e-74	1	247	87	324
UIZ23641.1|GH6	3.66e-71	1	237	91	324
CCA16954.1|GH6	1.58e-67	1	249	84	332
AIG55947.1|GH6	3.50e-65	1	237	74	301
AIG55792.1|GH6	9.89e-65	1	237	79	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JX5_A	4.64e-30	1	230	71	314	GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_B GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_C GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_D GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_A GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_B GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_C GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_D GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102]
1UP2_A	8.96e-23	2	230	75	288	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	1.21e-22	2	230	75	288	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UP3_A	1.21e-22	2	230	75	288	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	1.75e-22	2	230	96	309	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QYR9|CBHC_ASPNC	9.53e-19	1	230	181	451	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=cbhC PE=3 SV=1
sp|Q5B2E8|CBHC_EMENI	1.23e-17	1	230	177	447	1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cbhC PE=1 SV=2
sp|P46236|GUNB_FUSOX	2.28e-17	1	230	182	453	Putative endoglucanase type B OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|Q7SIG5|GUN6_HUMIN	4.85e-17	1	233	84	340	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|P07984|GUNA_CELFI	8.81e-17	1	230	239	443	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000026

TMHMM  Annotations     

Start	End
621	643