CAZyme Information: PGTG_22591-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_22591-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616	DS178366|CGC1	66331.81	6.2660

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178366:143741-146409(-)

Full Sequence      

MLDHGCKIFSLFFLALLPHGSNTATMPEMFDYIVVGGGQAGMAVASRLSEDPSLTVLVLE
AGGTGINNTGISIPGLVGTTLGTDIDWKYSTIPQAGANERQVYYPRGKVLGGSSAINFLI
STKAEKNDYNAIEKLGNPGWGWSEIDRASKKSEHLVIPPPDSPYLYNPLYHGLSGPVASS
FPKYVPPQFEPYFSAASMASVAERAIETTDPFGGDLEGAYIFPSAIDAHSARVTSATAYY
FPNQARPNLVVRTDAEVNKLISKKTEGQALQIVGVEYSSLGTVSRAMVNKEVVMSAGSIG
TPAILERSGIGKSSILQDLKIPVALDLPAVGANLADHPALLGTYRLRSGIVSSDDLLRNA
TFAGEQTSLYMTTGGGLLSHGISLLDYQTLKSIVTPEELLEGMKLLKHEPSTMSEEQFHA
ITDRILNGVAVEFLLINAFFESDNLPDPNTSYLTIATTLQHPLSRGSSHIHGQDPSQAPL
IDPGFLSHPFDAWLMVKAAKHARKIMEQPQYKKVILNEHFPGPSVQSDAEWLVSVKNRVR
TEYHPLGTCAMMPKSQAGVVDPQLKVYGTQNLRIVDASVIPIQIGAHPALTIYAIAEKAA
ELILKPTTKTLLPSVL

Enzyme Prediction     

No EC number prediction in PGTG_22591-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	29	605	2.1e-172	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.36e-101	23	605	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.11e-95	25	613	1	538	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.70e-44	462	599	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.64e-29	97	339	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	8.95e-24	28	592	54	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW13132.1|AA3_2	6.15e-119	16	603	21	619
QRV98565.1|AA3_2	1.72e-118	28	603	35	619
QRV98567.1|AA3_2	1.03e-115	16	603	21	615
CDI54770.1|AA3_2	1.25e-115	30	603	59	633
CDR49038.1|AA3_2	1.30e-114	30	604	54	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	3.55e-89	22	603	2	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	3.64e-80	30	603	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.00e-79	30	603	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	3.99e-79	30	605	6	584	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	8.58e-64	30	605	41	599	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A142PTM2|CITC_MONPU	2.11e-90	30	605	14	610	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	2.11e-90	30	605	14	610	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	2.04e-89	28	604	45	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.04e-89	28	604	45	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	1.70e-88	22	605	27	631	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001113	0.998851	CS pos: 23-24. Pr: 0.9647

TMHMM  Annotations     

There is no transmembrane helices in PGTG_22591-t26_1-p1.