CAZyme Information: PGTG_22163-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_22163-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516		58117.25	6.5921

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178318:220277-223119(-)

Full Sequence      

MEDEGKSLSSPTGSLSNKTRATTKFTPRQLPRPKYTSARGSRPGYVSAPGDGHLYLDGEL
FDFRSFKSVMFPSAMVCHLNAYTLCVNFFPGSTPTLLDGEEFQARDLVETIAAFGSPVSR
TYTLHVANGVFPDGKEKPSSSHILGWDNSTNDWIYNETNWRNIDKALDLARHHGVKLIIP
IINQDYGSSDTNWVGNFVDLIRHRYNIQNYTIAQQAVDWFTDREMIECYKKIISFYLNRI
NTFNGIRIGDDQTILAFETGNEMNWGYQNGSIAHDRPPPANWTIEIAHFIKLLAPKTLVM
DGSYSRNPKMAWEEEALASPFIDLHSYHFYGEGEAQPYHDCQLSLQNQVRVHKKTFIIGE
HGFFDKEAVWEAFYKNITCAGALVWSLRSHSENGGFVTHGEGNNIYSYHAAGFRYQTSKK
FDTQEADIISLTYDASYRILRLNPPPKPIPGNPEAFLVSNGTHAGISWRGAPWAQEYQVL
GVGLTLSGVPQDLQPCVGTFILTREMTQNLRPPTGV

Enzyme Prediction     

EC	3.2.1.78:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	105	395	4.3e-50	0.9921875

CDD Domains     

PGTG_22163-t26_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL41339.1|GH5	2.68e-102	141	459	5	343
CDR43041.1|GH5	1.66e-91	92	480	70	451
ALL40758.1|GH5	1.39e-46	298	479	1	179
AYQ73430.1|CBM23|CBM61|GH5	3.67e-44	94	479	83	446
UJF31796.1|GH5_41	2.35e-43	89	479	55	421

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QP0_A	5.72e-14	88	387	20	326	Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei [Rhizomucor miehei]
3PZ9_A	6.36e-09	157	392	96	347	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	9.97e-09	157	392	82	333	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FJZ3|MAN7_ARATH	7.26e-10	155	387	104	364	Mannan endo-1,4-beta-mannosidase 7 OS=Arabidopsis thaliana OX=3702 GN=MAN7 PE=2 SV=1
sp|Q10B67|MAN4_ORYSJ	1.32e-08	49	302	19	231	Mannan endo-1,4-beta-mannosidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN4 PE=2 SV=2
sp|Q9LW44|MANP_ARATH	1.93e-07	155	302	103	237	Putative mannan endo-1,4-beta-mannosidase P OS=Arabidopsis thaliana OX=3702 GN=MANP PE=5 SV=3
sp|Q6YM50|MAN5_SOLLC	2.47e-06	100	387	73	372	Mannan endo-1,4-beta-mannosidase 5 OS=Solanum lycopersicum OX=4081 GN=MAN5 PE=2 SV=1
sp|Q9FZ03|MAN2_SOLLC	2.47e-06	100	387	73	372	Mannan endo-1,4-beta-mannosidase 2 OS=Solanum lycopersicum OX=4081 GN=MAN2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PGTG_22163-t26_1-p1.