CAZyme Information: PGTG_21538-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_21538-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556	DS178285|CGC1	62245.47	6.3063

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178285:632290-635358(-)

Full Sequence      

MRSNLTKLALLGWIIGISDVVCQAQAPLRLQKSGIKQSDQDKQRAEEVKTTFIGAFDDYI
KFGFPADEVKPLSKTGRNTRNGWSATLVDSLDTLFVMDLQERFAQGVADTLKIDFSKSQT
EEGVSIFETTIRYIAGILSAYELSGATNAPLLDQARKLADKLLLCWQDDQQNLPFPFLDF
TTNKPVVRDYISAASAGSLIMEFDRLSFYTRQPKYLAYATKAVQTVIKTPSPLPGLPGLT
FGVKNQTILSNYATWGSGTDSYLEYLLKYGMLINNSDNSYYKTWKQAVQSSIQKLIQVSP
VRNLTYLGGYSTSSNTPDYEFSHLACFTGGNWLMGGKVFQDDQLIDYGLKLIATCMETYK
RTATGLGPEIFRFLGPKGETTDEKPSPQDLEFFRANGFYIANAAYHLRPEVIESVFYAWR
LTGDTQYQEFVWQAFKSLQKYCKAPASYSDIEDVNSSSNPKPKDASESFLYAETFKYIYL
TFSDPELLSLDQYVFNTEAHPFRYQGSQNSTSNSTSTTTTTSKKTGAKLGSTSAQVGRVS
SGLLLLCPLLIFFWLM

Enzyme Prediction     

No EC number prediction in PGTG_21538-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	52	503	7.3e-126	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	4.27e-160	52	503	2	452	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	3.66e-119	38	505	66	519	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	5.34e-04	72	226	420	567	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV76191.1|GH47	1.02e-134	52	501	2	455
QRW05096.1|GH47	2.87e-134	52	501	2	455
QRV91005.1|GH47	8.11e-134	52	501	2	455
QRW04952.1|GH47	3.47e-130	13	510	4	514
QRV84818.1|GH47	1.87e-127	30	501	20	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KKT_A	1.96e-86	5	501	9	505	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
2RI8_A	2.85e-86	44	501	5	470	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1HCU_A	1.88e-79	36	507	7	495	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	5.69e-59	42	502	20	465	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	6.98e-59	42	502	18	463	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8N417|MNS1B_ASPFN	3.55e-94	35	503	31	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|Q2ULB2|MNS1B_ASPOR	3.55e-94	35	503	31	507	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|A1CP08|MNS1B_ASPCL	5.14e-94	4	507	2	511	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|A2QAS2|MNS1B_ASPNC	3.57e-91	38	503	36	509	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	5.02e-91	38	503	36	509	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002305	0.997629	CS pos: 24-25. Pr: 0.9284

TMHMM  Annotations     

There is no transmembrane helices in PGTG_21538-t26_1-p1.